HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0441COG0274arCOG04320Deoxyribose-phosphate aldolasedihydropteroate synthase

HOG Organism Gene ID Name Annotation
cHOG0441 nrc1 VNG1859 deoC dihydropteroate synthase
cHOG0441 hmu HMUK1524 Hmuk_1524 deoxyribose-phosphate aldolase( EC:4.1.2.4 )
cHOG0441 hma RRNAC3429 deoC1 deoxyribose-phosphate aldolase
cHOG0441 hwa HQ3205A deoC deoxyribose-phosphate aldolase
cHOG0441 hla HLAC2141 Hlac_2141 deoxyribose-phosphate aldolase
cHOG0441 hbo HBOR09700 Hbor_09700 deoxyribose-phosphate aldolase( EC:4.1.2.4 )
cHOG0441 hut HUTA1388 Huta_1388 deoxyribose-phosphate aldolase
cHOG0441 hvo HVO_2610 HVO_2610 deoC deoxyribose-phosphate aldolase
cHOG0441 nph NP3200A deoC deoxyribose-phosphate aldolase
cHOG0441 hhi 656 deoC1 deoxyribose-phosphate aldolase
MUSCLE (3.6) multiple sequence alignment


3200|gene|nph       MDRDTFAARIDHTVLGPETAPGDVEAVLDAAAEYGMNACVPPCYVEAASDY----APDVT
13429|gene|hma      --MDDIPDRIEHTVLGPTTTPADVRTCLDEALQYGMRACIPPWAVPLATEY-----ANVP
656|gene|hhi        --MDDIPDRIEHTVLGPTTTPDDVRTCLDEALQYGMRACIPPCYLPLATEY-----ANVP
3205|gene|hwa       MNIEELAARIDHTVLGPTTTMDEVTDVLSDAAAYGMNACIPPCYLDAAGDTDMVTDSGVT
1859|gene|nrc1      MDRETLAARIDHTVLGPTTTRADVLSVVDDAEAHGMNVCIPPCYVADARDH---ASADRT
1388|gene|hut       --MDDILSRIEHTVLGPETTPADVEAVLDDASEYGLRACIPPCYLELAGEY---A-PDVE
2141|gene|hla       MDRDEFAASIDHTVLGPETTWGDVETILNEAADHGMNACIPPCYLPEAADY---ENAPKT
9700|gene|hbo       MDRTEFAARIDHTVLGPETTFADVQTVLDEADEYGMNACIPPCYVAEASEY---A-PDVT
                         :   *:****** *:  :*   :. *  :*:..*:**  :  * :      .   

3200|gene|nph       LVSVCGFPHGQHATETKATEAETVWQAGADEIDVVINVGRLRGGDTDAVRAEIEQVVAAV
13429|gene|hma      LTAVIDFPHGQGQTDSVCQAAKLAWDAGADELDMVCNVGLLKAGEDDAVRDHITEVVASV
656|gene|hhi        LTAVIDFPHGQGQTDSVCQAAKLAWDAGADELDMVCNIGLLKAGEDDAVRDHITEVVASV
3205|gene|hwa       LVSVIGFPHGQHASIAKRKEAVTAWQAGADEIDVVLNIGRLKTSATETVTHDIAEVVAAV
1859|gene|nrc1      IATVIGFPHGTQATSVKVAAAEHAHADGADELDLVIPIGRLKGGDHEAVTAEIAAVNDAT
1388|gene|hut       VATVIGFPHGNHTTAAKVAEAEDAVEAGADELDMVCNVGLLKAGEDDAVREDIESVVAAT
2141|gene|hla       IATVVGFPHGQHAPGVKRDEAVTAWDDGADEIDLVINVGRLKAGEDDAVAAEISDVVAAV
9700|gene|hbo       VATVVGFPHGQHSTAAKREEAVDAWENGADELDMVINIGRLKAGADDAVETDIAEVVAAV
                    :.:* .****   .      *  .   ****:*:*  :* *. .  ::*   *  *  :.

3200|gene|nph       PVPVKVIVEAPLLSASELRTACELAADADAAYLKTATGF-NGDATVAAVETMAEYLPVKA
13429|gene|hma      PVPVKVIVEAPLLSDAELERVGQLVADADAAYLKTATGFSEGGATVHDVEILSKYLPVKA
656|gene|hhi        PVPVKVIVEAPLLSDDELERVGQLVADADAAYLKTATGFSEGGATVHDVEILSKYLPVKA
3205|gene|hwa       PIPVKVIIETTLLNDDEKRRACKVAVDADADFIKTSTGFANGGATTADVEVLSSYLPVKA
1859|gene|nrc1      PLPVKVIIETPVLTDAEKHAACEAAADADAAMVKTATGFTDGGATVPDVSLMSEYLPVKA
1388|gene|hut       RKPVKVIIETPLLTDEEKHRASQLVADAGADFVKTATGFGGGGATVPDVELMSEYAPVKA
2141|gene|hla       PVPVKVIIETALLSDDEKRRACEAAVEADADMVKTSTGFADGGATIRDVELMSEYLPVKA
9700|gene|hbo       PIPVKVIIETALLTDDEKHRACEAAAEADADFVKTSTGFADGGATVEDVERMAEYLPVKA
                      *****:*:.:*.  *   . : ..:*.*  :**:***  *.**   *. ::.* ****

3200|gene|nph       SGGIGSFEAAVEMFDAGADRIGASAGAAIVDGFD----------PAAFET--------
13429|gene|hma      SGGVGSWADAKAMFEAGAERIGASSGDTIVREWQAETAGETVTEPESDRDGADTTDGY
656|gene|hhi        SGGVGSWADAEAMFEAGAERIGASSGDTIVREWQ----GETPTKPETDRDDADTTDGY
3205|gene|hwa       SGGISSYETAKSMLDAGAERIGASAGVEILEDA-----------PDIYYD--------
1859|gene|nrc1      SGGVGTYADAAAMFDAGAVRIGASSGVDIVASF-----------AE------------
1388|gene|hut       SGGVGSWADAKAMFDAGADRIGASSGDVIAEEY-----------FEAQEA--------
2141|gene|hla       SGGVGSYEEATAMLDAGAVRIGASSGVAIVEGH-----------PGDGD---------
9700|gene|hbo       SGGVGSYEEAMAMFDAGAERIGASSGVEIVSGI-----------PEA-----------
                    ***:.::  *  *::*** *****:*  *