HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0439COG0024KOG2738 KOG2775 KOG2776arCOG01001Methionine aminopeptidasemethionyl aminopeptidase

HOG Organism Gene ID Name Annotation
cHOG0439 nrc1 VNG1866 map methionyl aminopeptidase
cHOG0439 hmu HMUK1509 Hmuk_1509 methionine aminopeptidase, type II( EC:3.4.11.18 )
cHOG0439 hma RRNAC3421 map methionine aminopeptidase
cHOG0439 hwa HQ3208A map methionine aminopeptidase
cHOG0439 hla HLAC2052 Hlac_2052 methionine aminopeptidase, type II
cHOG0439 hbo HBOR09760 Hbor_09760 methionine aminopeptidase, type II( EC:3.4.11.18 )
cHOG0439 hut HUTA0071 Huta_0071 methionine aminopeptidase, type II
cHOG0439 hvo HVO_2600 HVO_2600 map methionine aminopeptidase type II
cHOG0439 nph NP3190A map methionine aminopeptidase
cHOG0439 hhi 649 map methionine aminopeptidase
MUSCLE (3.6) multiple sequence alignment


1866|gene|nrc1      --------------------MTDSVTVGSDAYEQYVEAGDILTTVLSEAADRVTVGATHL
2052|gene|hla       ---------------------MSHGSLDDDAVESYREAGAVLVEAMNEAREMVEPGRTHL
3190|gene|nph       ----------------------MSVDLSDEKFEKHREAGEILAQVREEAAERVEVGVSHL
71|gene|hut         MPDRQLAATGKHLPPSVDRGSMSDVDFSVEKYEKHRHAGEILAEVRDEAAERVEVGVSHL
13421|gene|hma      ---------------------MTDVDFDSEQYEKCREAGEILAQVRDEAAERVEVGVSHL
649|gene|hhi        ---------------------MTDVDFDSEQYEKCREAGEILAQVRDEAAERVEVGVSHL
3208|gene|hwa       ---------------------MASASLAEETRSKYRKAGQVLQQVLDEAATKVEPGTTHL
9760|gene|hbo       ---------------------MSIGPLDEETVEKYREAGQILRQVLDETAEMVEPGVTHL
                                              .  :  ..   ** :*  . .*:   *  * :**

1866|gene|nrc1      EVASFAEERIRELGGEPAFPVNISVNEEASHAAPGADDDTEFGEDMVCLDVGVHVDGHIA
2052|gene|hla       EVAEWTEDFIREQDAGLAFPVNISVDPEASHATPSRDDDTEFGEEMVCLDVGVHVDGYIA
3190|gene|nph       DVAEYAEERIRELGGEPAFPVNISIDEEAAHATPAPDDESEFGEEMVNLDIGVHVDGWLA
71|gene|hut         EIAEWAEDRIRELGGKPAFPVNISIDEEAAHATPSIDDEATFGEELVNLDIGVSIDGWLA
13421|gene|hma      EVAQWAEDKIRELGGKPAFPVNISIDEEAAHATPERDDDATFGEEMVNLDIGVHVDGWLA
649|gene|hhi        EVAQWAEDKIKELGGKPAFPVNISIDEEAAHATPERDDDATFGEEMVNLDIGVHVDGWLA
3208|gene|hwa       EVAKFAESRIRELADGCAFPANISVNEEASHATPGADDEAVFDDELVCLDCGVHVDGYIA
9760|gene|hbo       EVAEYAEDRIYELADGCAFPVNISVNEEASHASPGRDDETEFGEDMVCLDCGVHVDGYIA
                    ::*.::*. * *     ***.***:: **:**:*  **:: *.:::* ** ** :** :*

1866|gene|nrc1      DAATTVDLSGTPELVEAAEESLAAAIDMVEPGVQTGALGAEIQDVVEAYGYNPVVNLTGH
2052|gene|hla       DAAVTVDHTGTPELVEAAEMALEAAVDEAGPGVEVGVVGQAIEDVIRGYGYTPVLNLSGH
3190|gene|nph       DTAVTVDLSGNAELAEASAEALEAAIDVVEPGVHTGEIGAEIESVIDGYGYNPVVNLSGH
71|gene|hut         DTAVTVNLSGHDELTEASEEALDAALEIVEPGVETGEIGRVVEETIDGYGFNPVVNLTGH
13421|gene|hma      DTAVTVDLSGQDELAKAPEEALDAALDVAGPGVDVGQIGAAVEEVIEGYGYNPVVNLTGH
649|gene|hhi        DTAVTVDLSGQDELAEAPAEALDAALDVAGPGVDVGQIGAAVEEVIEGYGYNPVVNLTGH
3208|gene|hwa       DAAVTIDLSGTPTLVEAAEEALDAALEIIAPGVETSTVGTEIEDVIRGYGYTPVLNLSGH
9760|gene|hbo       DAAVTVDLSGNAELKEAAEEALDAALDAVAPGVQTGAVGAEIEDVIRGYGYTPVLNLSGH
                    *:*.*:: :*   * :*.  :* **::   *** .. :*  ::..: .**:.**:**:**

1866|gene|nrc1      GMDVFDAHTGPTVPNRGVDSGAELAVGDVVAIEPFVTTGTGKVTEGAATEIYEVVSSGTV
2052|gene|hla       GVERYDAHTGPTVPNRGVDRSVELEPGQAVAIEPFATDGRGKVGEGTEEEIFERQGSGSV
3190|gene|nph       GLGHWEQHTEPNIPNRGVQQGVELEVGDVVAIEPFATDGGGKVSEGATEEIYALEREASV
71|gene|hut         GLGQYEQHTEPNIPNRAVSQSATLSAGDVVAIEPFATDGAGKVREGSDEEIFALDREGSV
13421|gene|hma      GLGHWEQHTSPNIPNREVAQGATLDVGDVVAIEPFATDGRGKVQEGADEEIFALEREGSV
649|gene|hhi        GLGHWEQHTSPNIPNREVAQGATLDVGDVVAIEPFATDGRGKVQEGADEEIFALEREGSV
3208|gene|hwa       GVGQWDAHTSPNVPNRGTERGIEFEVGDVVAIEPFATTGRGKVSEGTNAEIYSLEHDRSV
9760|gene|hbo       GVEQWDAHTGPNVPNRGAERGIEFEVGDVVAIEPFATTGSGKVTEGAKEEIYSLERDRSV
                    *:  :: ** *.:*** .  .  :  *:.******.* * *** **:  **:    . :*

1866|gene|nrc1      RDRRARQLLDDL-EQFDGLPFAARWLDGARAEMSLTRLERADIVRSYPVLKEADGELVGQ
2052|gene|hla       RDRRARQALDEI-EAFDDLPFAARWLEGDRVEMALRRLKQANAVKGYPVLKEADDALVSQ
3190|gene|nph       RDRGARQALEQIVEEFKTLPFARRWLETSRAEMALRRLKQKNVVHGYPVLKEEDGCLVSQ
71|gene|hut         RNRRARQALEQITEEFKTLPFATRWLDVKRPSMALKRLKRNDIVHGYPVLKEEAGKYVSQ
13421|gene|hma      RNRQARQVLEQITDEYRTLPFAARWLDSPRAEMALRRLKQQDIVHGYPVLKEQDGAYVSQ
649|gene|hhi        RNRQARQVLEQITEEYRTLPFAARWLDSPRAEMALRRLKQQDIVHGYPVLKEQDGAYVSQ
3208|gene|hwa       RNRAARQVLQQVTDEYKTLPFATRWLESDRAEMAVRRLEQRGILHGYPVLKEDDGELVSQ
9760|gene|hbo       RNRSARQVLEQVKDEYKTLPFAARWIDAPRADIAIQRLKQQNVLHGYPVLKEDDGELVSQ
                    *:* *** *::: : :  **** **::  * .::: **:. . :..******  .  *.*

1866|gene|nrc1      DEHTLIVTEDGCEVVTA-------
2052|gene|hla       AEHTLLVTDDGVEITTAGIHDFDG
3190|gene|nph       KEHTVLVTEDGCEVTTRPR-----
71|gene|hut         KEHTIIVTDDGCEVTTRSR-----
13421|gene|hma      KEHTVIITEDGCEVTTRSR-----
649|gene|hhi        KEHTVIITEDGCEVTTRSR-----
3208|gene|hwa       AEHTVIITEDGCEVITA-------
9760|gene|hbo       AEHTIIVTEDGCEILTE-------
                     ***:::*:** *: *