HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0437COG2766arCOG02891Putative Ser protein kinaseprotein kinase

HOG Organism Gene ID Name Annotation
cHOG0437 nrc1 VNG0749 prk protein kinase
cHOG0437 hmu HMUK2231 Hmuk_2231 putative serine protein kinase, PrkA
cHOG0437 hma RRNAC1067 hypothetical protein
cHOG0437 hwa HQ3003A prkA serine protein kinase
cHOG0437 hla HLAC0032 Hlac_32 putative serine protein kinase, PrkA
cHOG0437 hbo HBOR13600 Hbor_13600 putative Ser protein kinase
cHOG0437 hut HUTA0412 Huta_0412 putative serine protein kinase, PrkA
cHOG0437 hvo HVO_2849 HVO_2849 prkA PrkA protein.
cHOG0437 nph NP3444A prkA_1 serine protein kinase 1
cHOG0437 hhi 1676 prkA1 putative serine protein kinase, PrkA
MUSCLE (3.6) multiple sequence alignment


10672|hp|hma       ---MTLTFEPLDDRPGLAVIDQI-ERQRYRIHTPT----PIALREA---AADVFQY----
749|gene|nrc1      ---MTETLDRLSEQYAESVPADLRDTQSFQWYLDTLYDDPTVARNAHQRLADMFDYYGKT
32|gene|hla        -MPNRHTLERLSEEYRTNVPDDLREPRSFNWYLDALYEEPRIARNAHQRVADMFDHYGTQ
3003|gene|hwa      MNGNRATLETLSSQYKDSVPSDLRDAKRFDWYLDELYNDPRIARNAHQRVADMFDHYGTE
13600|hp|hbo       MNGDIDTLEDLSKHYKDSVPADLREAKSFEWYLDEVYNDPRIARNAHQRVADMFDYYGTE
412|chp|hut        MNGTRNTLETLNEHYRDSIPADLRETRSFQWYLDELQASPKIARNAHQRVADMFDHYGTE
3444|gene|nph      ----METLEELSKEYRDTIPSDLRRVHSFEWYLETLYEDPKVARSSHQRLADMFDYYGTE
1676|gene|hhi      MSKNKETLEALSKEYRDTIPADLRKTNTFDWYLQQLYDEPKVARNAHQRVADMFDYYGKT
                         *:: *..     :  ::   . :  :       *   *.:    **:*::    

10672|hp|hma       ----------------PVGDA-------------------VRIRTRAIELPTVVMV----
749|gene|nrc1      TDDD-GVVEYRLASEDPLGEGANTFFGREVHESIHEFVNKVKSGARGLGPEKRIILLLGP
32|gene|hla        YDEERGVVEYALAADDPLHDGENVFYGREVHEAIHEFVNKVKSGARGLGPEKRIKLLLGP
3003|gene|hwa      YDEDAGVVEYCMASEDPLHDGENTFYGREVHESIHEFVNKVKSGARRLGPEKRIKLLLGP
13600|hp|hbo       YDEEAGIVEYLMASEDPIHDGENTFYGREVHESIHEFVNKVKSGARGLGPEKRIKLLLGP
412|chp|hut        YDEDEGVVEYALAATDPLDEGENTFYGRVIHEAIHEFVNKVKSGSRGLGPEKRIKLLLGP
3444|gene|nph      YDEEAGVVEYALAAEDPLDEGENTFYGRGIHESIHEFVNKVKSGARGLGPEKRIKLLLGP
1676|gene|hhi      YDEEAGVVEYELASEDPLNDGENTFYGRVIHEAIHEFVNKVKSGARGLGPEKRIKLLLGP
                                   *: :.                   *.  :* :   . : :    

10672|hp|hma       ------------------YVRDDDGAIAA----EVAQFESETLPADDYVLDPLTQIKPYM
749|gene|nrc1      VGSGKSDVDRQVRRYFEDYTAQREGRLYTFRWTDLCSVIDDQDPNDDTITSPMHQD-PLV
32|gene|hla        VGSGKSHFDWLVRRYFEAYTREDAGRMYTFRWVNLCSVIDDQDPGDDTVRSPMNQD-PLV
3003|gene|hwa      VGSGKSHFDWMVRRYFEAYTASDAGRMYTFRWKNLMDVIPDQDPADDTVQSPMNQD-PLV
13600|hp|hbo       VGSGKSHFDWMVRRYFEDYTLRDEGRMYTFRWTNLTDVIRDQDPADDVVPSPMHQD-PIV
412|chp|hut        VGSGKSDFDRQVRRYFEDYTIRDAGRMYTFRWTNLRDVIPDQDPDDDTVRSPMNQD-PLV
3444|gene|nph      VGSGKSDFDRQVRQYFEDYTARDEGRMYTFRWTGLCDILGDQDPSDDVVRSPMNQD-PLV
1676|gene|hhi      VGSGKSDFDRQVRRYFEDYTSRDDGRMYTFRWTNLCDVIHDQDPADDVVRSPMNQD-PLV
                                     *.    * : :     : ..  :  * ** : .*: *  * :

10672|hp|hma       RVEDAEVEVTVDSDRTRIEFDAPTDLLIGARSQHDRPAATVTTTEQPA----DVMAAVET
749|gene|nrc1      LLPEAQRQQVI--DDLNEDLDAPYSL---RNSQSLDPESEFYMDELLAHYDDDLQAVLES
32|gene|hla        LIPRPQREGVI--DELNERLDAPYTL---RNDQHPDPASEFYLNELLAHYDDDLQRVLDN
3003|gene|hwa      LLPQEQRDIVL--DRLNDELDAPYTI---QNGQSLDPASEFYMDKLLAHYNDDLEAVLQN
13600|hp|hbo       LLPQEQRDMVI--ERLNEALDAPYTI---RNDQALDPASEFYMDQLLAYYDDDLQEVVSN
412|chp|hut        LLPQEQRDRVL--EDLNEALEAPYTI---RNEQSPDPASEFYMDRLLAHYDDDLQSVLEN
3444|gene|nph      LLPPKQRERVL--EDINEALDAPYTI---RNEQALDPASEFYMDALLEHYDDDLQQVLEN
1676|gene|hhi      LLPQEQRDKVI--EDINAELDAPYTI---RNEQSLDPASEFYMDRLLAEYDDDLQSVLEN
                    :   : : .:  :  .  ::**  :    . *   * : .           *:  .:..

10672|hp|hma       FGSALKAHDPERSYPTLRGH-PPALEIGDTLDIPADIDSPDTGVTLELPP---DLASIFV
749|gene|nrc1      HVEVVRLVASENRRDCIETFEPKDKKNQDETELTGDVNYSKLAVYGESDPRAFDYAGAFC
32|gene|hla        HVEVVRLVADENRRECIETFEPKDKKNQDETELTGDVNYAKLAVYGESDPRAFDYAGAFC
3003|gene|hwa      HVEIIRLVASENKRQCVETFEPKDKKNQDETELTGDVNYSKLAVYGESDPRAFDYSGAFC
13600|hp|hbo       HIEIVRLVASENKRQCIETFEPKDKKNQDETELTGDVNYSKLAVYGESDPRAFDYSGAFC
412|chp|hut        HVEIIRLVADENMRQAIETFEPKDKKNQDETELTGDVNYSKIAVYGESDPRAFDYSGAFC
3444|gene|nph      HIEVVRLLADENKRQAIETFEPKDKKNQDETELTGDVNYSKIAVYGESDPRAFDYSGAFC
1676|gene|hhi      HIEIIRFVADENQRRGIETFEPKDKKNQDETELTGDVNYSKIAIYGESDPRAFDYSGAFC
                   . . :.    *.    :  . *   :  *  ::..*:: .. .:  *  *   * :. * 

10672|hp|hma       AAPLSYYLGASLVPASEPRLTTDTGFTYSLDTARGFESEVGRTLKRLFFLDCVTRTEGFH
749|gene|nrc1      NANRGIFSGEELL-----------------------------KLQREFLYDFLHATQ---
32|gene|hla        NANRGLFSGEELL-----------------------------KLQREFLYDFLHASQ---
3003|gene|hwa      NANRGLFSGEELL-----------------------------KLQREFLYDFLHASQ---
13600|hp|hbo       NANRGLFSGEELL-----------------------------KLQREFLYDFLHASQ---
412|chp|hut        NANRGIFSGEELL-----------------------------KLQREFLYDFLHATQ---
3444|gene|nph      NANRGIFSGEELL-----------------------------KLQREFLYDFLHATQ---
1676|gene|hhi      NANRGIFSGEELL-----------------------------KLQREFLYDFLHASQ---
                    *  . : * .*:                             .*:* *: * :  ::   

10672|hp|hma       QIDLHERAAIEPYVDLDFQSLYQQPLAEQVATYLQVPYDVIEDHIPKWRLTTHIDPVPAN
749|gene|nrc1      --EQTIKPKNNPRIDIDQVIVGRTNMPEYQDKRADEKMEAFNDR------TKRVD-----
32|gene|hla        --ESTIKPKNNPRIDIDQVIVGRTNMPEYREKTGDEKMEAFNDR------TKRID-----
3003|gene|hwa      --EQTIKPKNNPRIDIDEVIVGRTNMPEYREKKGDEKMEAFNDR------TKRVD-----
13600|hp|hbo       --EQTIKPKNNPRIDIDQVIVGRTNMPEYRDKKGDEKMEAFNDR------TKRID-----
412|chp|hut        --EQTIKPRNNPRIDIDQVIVGRTNMPEYREKKGDEKMEAFNDR------TKRID-----
3444|gene|nph      --EQTIKPKSNPRIDIDQVIVGRTNMPEYRDKKGDEKMEAFNDR------TKRID-----
1676|gene|hhi      --EQTIKPKNNPRIDIDQVIVGRTNMPEYRDKKGDEKMEAFNDR------TKRID-----
                     :   ..  :* :*:*   : .  :.*   .  :   :.::*.      *..:*     

10672|hp|hma       AEQLPYVVDDLAIVRTHQQQRLNQASVPAEAEAEFTRD-----DVITRAASSDAGTATAE
749|gene|nrc1      ---FPYVLEYDREAKIYEKL-LGNADVPDIHVEPHTLTMAGLFGVLTRIREPDTDAIGLL
32|gene|hla        ---YPYVLEYESEAKIYEKM-LNNADVPNVHVEPHALEMAGLFGVLTRLEEPADETVSLL
3003|gene|hwa      ---FPYVLEYDEESEIYRKM-LRNADVPDMHIEPHALEMAGLFGVLTRLAEPDT-NASLV
13600|hp|hbo       ---FPYVLEYSEESEIYRKM-LRNADVPDMHIEPHTLEMAGLFGVLTRIVEPDGGNITLT
412|chp|hut        ---FPYVLSYGDEAMIYRKM-LRNADLPDIHVEPHTLEMAGLFGVLTRIEEPDESSVSIL
3444|gene|nph      ---FPYVLQYDAEARIYRKM-LKNADVPEMHVEPHTLEMAGLFGVLTRIEEPDGGTISIL
1676|gene|hhi      ---FPYVLQYEAEANIYQKM-LRNADLPDIQVEPHTLEMAGLFGVLTRIEEPDNESIDLV
                       ***:.       : :  * :*.:*      .:       .*:**  ..        

10672|hp|hma       TDYVEPQAHDSLEQAWIGDSIPIGASKLTKAAFEHRLDRDTNAEDITIRVVQNDARMDEE
749|gene|nrc1      E---KAKAYNGE----LDDIDDVDPEKLREEA-EVTGDR-EGMDGVSPRFVGDEI----A
32|gene|hla        D---KAKVYNGE----LED-EEIDRRKLREDA-AESADVGEGMDGISARFVGDEI----A
3003|gene|hwa      Q---KAKAYNGE----LDDGDDVDVRKLRENA-EESTDIGEGMDGVSARFIGDEI----A
13600|hp|hbo       Q---KAKAYNGE----IDEGDDTDVKKLREEA-ESKMNIGEGMEGVSARFIGDEI----A
412|chp|hut        Q---KAKAYNGE----NEEAEDVDLKKLREEA-AESADIGEGMDGVSPRFIGDEI----A
3444|gene|nph      Q---KAKAYNGE----IDEGEDIDVTKLREEG-DTTADIGEGMDGVSPRFIGDEI----A
1676|gene|hhi      Q---KAKAYNGE----IDEADDVDVKKLREEA-EKMADIGEGMDGVSPRFIGDEI----A
                       :.:.::.       :    .  ** : .     :   . :.:: *.: ::      

10672|hp|hma       RQLVDEVYGTRDDL-PFDVTVHDNLTTAELRTVLTTDAEFFHYIGHTEHDGFVCSDGKLD
749|gene|nrc1      AAIMESMDRDRGFLSPLTVFNRVEDNLPQHGSIPEDHVADYQRVLEQVREEYK-ERAIED
32|gene|hla        EAIMDATHRDRSYLSPLSVFDHFEANLGGHGSIAEADLDRYERLLETVREEYR-ERAIED
3003|gene|hwa      EAIMDATHRDRTYLSPLSVFSHFETNLENHGSIPEENLDQYHRYLEMVREEYR-ERAIED
13600|hp|hbo       EAIMDSTHRDRNYLSPLSVFTHFEENLENHGSIPEDNLERYHRYLEMVREEYK-ERAIED
412|chp|hut        EAIMDSMHRDRDFLSPLTAFNHFEANLEHHGSIPAERFETYYRYLELTREEYR-DRAIDD
3444|gene|nph      EAIMDSMHRGRTFLSPLAAFNHLEENLENHGSIPEEQFEDYYRYLELVREEYK-ERAIED
1676|gene|hhi      EAIMDSMHRSRDFLSPLTTFNHLEGNLENHGSIDEESFSKYYRFLELVREEYK-ERAIED
                     :::     *  * *: .  . : .     ::       :       .: :  . .  *

10672|hp|hma       VTTVDSVGIDTFLLNACNSYNQGLGLVEKGAIAGIVTLNEVLNDGAV--RIGEAVARLLN
749|gene|nrc1      VRHALAYDLDEIQRQGEKYMDHVMAYIDDDTVADELTGREQEPDETFLRAVEEQLGVPGD
32|gene|hla        VRHALAYDVDELRRQGEKYMDHVMAYIDDATVDDELTGRETEPDETFLRAVEEQLDVPSD
3003|gene|hwa      VRHALAYDLDEIQRQGEKYMDHVMAYIDDATVEDALTGREQDPDETFLRSVEEKLDIPED
13600|hp|hbo       VRHALAYDLDEIQRQGEKYMDHVMAYIDDATVQDELTGREQDPDEKFLRSVEEKLDIPED
412|chp|hut        VRHALAYDVEEIQRQGEKYMDHVMAYIDDDTVEDELTGREAEPDEQFLRSVEEHLDIPED
3444|gene|nph      VRHALAYDLDEIQRQGEKYMDHVMAYIDDDTVEDELTGREQDPDEAFLRAVEEKLDVPGD
1676|gene|hhi      VRHALAYDMDEIQRQGEKYMDHVMAYIDDATVEDELTGREQEPDEQFLRSVEEKLNLPED
                   *  . : .:: :  :. :  :: :. ::. :: . :* .*   *  .   : * :    :

10672|hp|hma       CGFPLRAALTIARKKSVLGGQYIVVGDGGVTVAQTENGTPNLLDVSATTAGYNVEMKAYS
749|gene|nrc1      RKDDFRQEVSNWVSRRAREGEPFDPQDNDRLRRALER---KLWEDKKHNINFSALVSNAD
32|gene|hla        RKDDFRQEVSNWVSRRAREGRGFDPRENDRLRRALER---KLWEDKKHNINFSALVSATD
3003|gene|hwa      RKDDFRQEVSNWVSRRAREGTSFDPHDNDRLRRALER---KLWEDKKHNINFSALVSANE
13600|hp|hbo       RKDDFRQEVSNWVSRRAREGQAFDPQDNDRLRRALER---KLWEDKKHNINFSALVSANE
412|chp|hut        RKDDFRQEVSNWVSRRAREGDTFSPQDNERLRRALER---KLWEDKKHNINFSALVASSE
3444|gene|nph      RKDDFRQEVANWVSRRAREGEPFEPQDNDRLRRALER---KLWEDKKHNINFSALVSSGD
1676|gene|hhi      RKDDFRQEVSNWVSRRAREGDTFNPQDNDRLRRALER---KLWEDKKHNINFSALVSSSE
                       :*  ::   .. .  *  :   :.       *.   :* : .  . .:.. :   .

10672|hp|hma       MDNKGLGAIVFPFFEECEEYFLAPGSVGSFNISSSELSEFLQMQQVPVKADGDLYWSDSM
749|gene|nrc1      VDEEQDNEWVAALVDRG---YSEDGAREVLEFAGAEVAK--------------------A
32|gene|hla        LDDEERSAWVDALVDRG---YSEDGAAEVLEYAGAAVAR--------------------S
3003|gene|hwa      LDDDERNAWIEALVDRG---YSQAGAQEVLEFAGAEVAK--------------------S
13600|hp|hbo       LDDDERNAWVDALVEQG---YSREGAREVLEFAGAEVAK--------------------S
412|chp|hut        MDDDDRNAWIEALLEQG---YSRDGAVEVLEFAGAEVAK--------------------T
3444|gene|nph      LDDDERNAWVDALEEQG---YSTDGAKEVLEFAGAEVAK--------------------S
1676|gene|hhi      MDDEERNQWIDALIEQG---YSEEGAKEVLEFAGAEVAK--------------------S
                   :*:.  .  : .: :     :   *:   :: :.: ::                      

10672|hp|hma       ELEDIS-
749|gene|nrc1      ELES---
32|gene|hla        EIENGGD
3003|gene|hwa      ELEA---
13600|hp|hbo       ELEG---
412|chp|hut        ELEE---
3444|gene|nph      ELEE---
1676|gene|hhi      EMEE---
                   *:*