HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0436arCOG04774hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0436 nrc1 VNG1798 vng1798 no entry
tucHOG0436 hmu HMUK1640 Hmuk_1640 conserved hypothetical protein
tucHOG0436 hma RRNAC3352 hypothetical protein
tucHOG0436 hwa HQ3320A hypothetical protein
tucHOG0436 hla HLAC1949 Hlac_1949 hypothetical protein
tucHOG0436 hbo HBOR07530 Hbor_07530 hypothetical protein
tucHOG0436 hut HUTA0063 Huta_0063 conserved hypothetical protein
tucHOG0436 hvo HVO_2343 HVO_2343 conserved hypothetical protein
tucHOG0436 nph NP4518A hypothetical protein
tucHOG0436 hhi 591 HAH_0591 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1798|hp|nrc1      ----------------------------------------------------MKLRQNLR
3320|hp|hwa       ----------------------------------------------------MKIRQNIR
7530|hp|hbo       ----------------------------------------------------MKIRQNIR
63|chp|hut        ----------------------------------------------------MKIKQSVK
13352|hp|hma      MPSPMITCDVLMYGRYEIRPNVDCYLRIVSDSELNTPIVGDLKALGPVFEIEMKIYQNPR
591|hp|hhi        --MWIAIC---------------VSFAILRGTPRRTPIVEDLKALGPVSVIEMKIYQNPR
1949|hp|hla       ----------------------------------------------------MKIRQNIR
4518|hp|nph       ----------------------------------------------------MKLYQNPR
                                                                      **: *. .

1798|hp|nrc1      HFASQKALEVPGLRDVVHDKLVDIHTSIFLDKATEARRDEREAHLDGFFDASMEMYLVAL
3320|hp|hwa       HFAAKKALTMPIIGDIATQKLVDLHVSIFGKKADPEYREEREPHLETFFDCTFETYVRAL
7530|hp|hbo       HFAAKKALTMPVVGDIATDKLVGLHVRVFGEKADPDHREEREPHMEAFFDCTFDTYVAAL
63|chp|hut        HWAAKQSLTAPVVGEMVSDKLVDLHTGVFLDWAEENRQEERRERLEGFFDATMDTYVAAL
13352|hp|hma      HWASKKALTTPGVRSVANYGLVKLHTKIFLGKADEAHREERRDHLDDFFDGTMDTYVAAL
591|hp|hhi        HWASKKALTTPGVRSVANYGLVKLHTKIFLGKADEAHREERRDHLDDFFDATMDTYVATL
1949|hp|hla       HWAAKKALTTPVVGDVANDKLVDLHTSIFLNKADEDRREERRAHLDSFFDATMDTYVAAL
4518|hp|nph       HWASKQALTTPGLRGAANYALVKLHTKIFLGKADADRREERRDHLDDLFDATIDAYVAAL
                  *:*::::*  * :   .   ** :*. :*  .*    .:**  .:: :** ::: *: :*

1798|hp|nrc1      QSGLPEAQAREITHIVANFDFYNHGWTEMMEFPGDELRDHYDRHADFFDEHDITIDNPLG
3320|hp|hwa       EEGFTEAEAREITHIQANFDFYNHGWTEMMEFPAEELETHYERYEEFFNRYNIDIASPLG
7530|hp|hbo       ESGFSEAKAREITHIQANFDFYNHGWTEMMEFPADELEAHYERYEEFFQRYDIDIANPLG
63|chp|hut        EEGHPEAEAREITHAQANFDFYNHGWTEMMEFPVEEVEAHYDRYADFFESHGITIDDPLG
13352|hp|hma      EAEYSEAEAREITHIQANFDFYNHGWTEMMEFPADELEAHYERYADFFDAHSITIDDPLG
591|hp|hhi        QADYSEAEAREITHIQANFDFYNHGWTEMMEFPADELEAHYERYADFFDAHDITIDDPLG
1949|hp|hla       EAGFPEAEAREITHVQANFDFFNHGWTEMMEIPGDELEPHYRRYESFFGDHGITIDDPLG
4518|hp|nph       EADYTEAEAREITHIQANFDFFNHGWTEMMEIPADELEPHYRRYESFFQEHGITIDDPLG
                  :   .**:******  *****:*********:* :*:  ** *: .**  :.* * .***

1798|hp|nrc1      AFQPADGIPDAPATPEKLADADFENAAAGFEDDVYVETDDG--IQKGGVDEPDDVDPEDS
3320|hp|hwa       DFKTQN-IIAASSTPGRLNNPEHPHAEGGFADDVYVETESGELTVGGQ-TEPDTVNVEDA
7530|hp|hbo       DFRTQD-IPEAPSTPEKLDDPEHPHAVGGFADDVYVEDESGELHVGGQ-EEPEDVDVSAA
63|chp|hut        AFAPEGGLPEAPSTPEKLDDPDHPHAIGGFADDVYVETEDGEIVIGGG-EKPEEVDVEEA
13352|hp|hma      TFRPAGGVTDAPSTPERLDEPEHPHAVGGFADDVYVETEDGEMLVGGGREEPDDVSPTDA
591|hp|hhi        TFRPAGGVTDAPSTPERLDEPEHPHAVGGFADDVYVETEDGEMVVGGGREEPDDVSPTDA
1949|hp|hla       EFRPAEGIVEATETPEKLETPEYENALAGFADDVYVETDDGETVVGGETEEPEEVDPSAA
4518|hp|nph       EFRPAGGLTSAPETPEKLDEPAFENAIAGFADDVYVETADGETVVGGDTEPPEDVDPTAV
                   * .   :  *. ** .*  . . :* .** ******  .*     *    *: *.    

1798|hp|nrc1      PFAE------------
3320|hp|hwa       PGLQDVDTDTDETTEA
7530|hp|hbo       PGVNDTDVDESEA---
63|chp|hut        PGVDPDAVEDAEIEG-
13352|hp|hma      PVIDEDDVESAAGD--
591|hp|hhi        PVIDEDDVESAAGD--
1949|hp|hla       PGLDEDEASA------
4518|hp|nph       PGVDDEEAQAD-----
                  *  :