HOG Organism Gene ID Name Annotation
aHOG4353 hbo HBOR23370 Hbor_23370 aldo/keto reductase, diketogulonate reductase- like
aHOG4353 hwa HQ1533 oxr aldo/keto reductase family oxidoreductase
MUSCLE (3.6) multiple sequence alignment


23370|gene|hbo      -MSEQSLTTEDVPLANGMPMLGLGTWQNDEPEDCARAVETALNMGYRHIDTAQIYGNEEF
1533|gene|hwa       MMARQSPTSSVAPTADGMPLLGLGTWENDNPSECANTIKTALEMGYRHIDTAQVYGNEGA
                     *: ** *:. .* *:***:******:**:*.:**.:::***:**********:****  

23370|gene|hbo      VGEGIENATVPREDIFLATKVWIDNLSYDEVLATTEESLEKLGVESVDLLYVHWPAREYD
1533|gene|hwa       VGQGIAAADVPREEMFIATKVWIDKLGYEDVLTSTQRSLEKLGIDTVDLLYVHWPVDTYN
                    **:**  * ****::*:*******:*.*::**::*: ******:::*********.  *:

23370|gene|hbo      PEETFRAFNELYDEGKIDRIGISNFEPEQIETAVKSADVPIFANQVELHPLLQQEDLRAA
1533|gene|hwa       PVETFRALHKLVSDGKADRIGISNFEPNQVDTAIEKANVPIFANQIEIHPLLPQQELRDH
                    * *****:::* .:** **********:*::**::.*:*******:*:**** *::**  

23370|gene|hbo      CEEHDIEVVAYSPLARGTVFEVPELEAIAEKHGVSEAQVSLAWLREKGVTAIPKATGEDH
1533|gene|hwa       CSKHDIELVAYSPLARGAVFDVPEITAIANNHDVSEAQIALAWLRQKGITAIPKAVGHDH
                    *.:****:*********:**:***: ***::*.*****::*****:**:******.* **

23370|gene|hbo      IRDNWQSLRVELDAEDIDRIDNIERTDRRVDPDFAPW
1533|gene|hwa       IHDNWTSLDLELTPAEIEQIDSIERTNRCVDPRFAPW
                    *.*** ** :** . :*:.**.****:* *** ****