HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0435COG0072KOG2472arCOG00412Phenylalanyl-tRNA synthetase beta subunitphenylalanyl-tRNA synthetase subunit beta

HOG Organism Gene ID Name Annotation
cHOG0435 nrc1 VNG2505 pheY phenylalanyl-tRNA synthetase subunit beta
cHOG0435 hmu HMUK0663 Hmuk_0663 phenylalanyl-tRNA synthetase, beta subunit( EC:6.1.1.20 )
cHOG0435 hma RRNAC2967 pheT phenylalanyl-tRNA synthetase subunit beta
cHOG0435 hwa HQ1050A pheT phenylalanyl-tRNA synthetase subunit beta
cHOG0435 hla HLAC2670 Hlac_2670 phenylalanyl-tRNA synthetase, beta subunit
cHOG0435 hbo HBOR03100 Hbor_03100 phenylalanyl-tRNA synthetase beta subunit( EC:6.1.1.20 )
cHOG0435 hut HUTA1676 Huta_1676 phenylalanyl-tRNA synthetase, beta subunit
cHOG0435 hvo HVO_2947 HVO_2947 pheT phenylalanyl-tRNA synthetase beta subunit
cHOG0435 nph NP0694A pheT phenylalanyl-tRNA synthetase subunit beta
cHOG0435 hhi 227 pheT phenylalanyl-tRNA synthetase subunit beta
MUSCLE (3.6) multiple sequence alignment


2505|gene|nrc1      MPVVDIDPDELRRLTGHRSKDDDELRQDLFGLGIEYEGETEDGDFKLEFEADRLDRLSVE
12967|gene|hma      MPVVDVDPDELRYLTGHSEKDDDELKSDLFNLGLEFEGWTEDDEFQLEFAPDRLDRLSVE
227|gene|hhi        MPVVDVDPDELRYLTGHDEKDDDELKSDLFNLGLEFEGWTEDDEFQLEFAPDRLDRLSVE
694|gene|nph        MPVVEVDPDELRSLAAIEDKSDDELKDDLFALGLEFEGESDDGDFELEFAPDRLDRLSVE
1676|gene|hut       MPTVDIDTDELRELTGHGEKSDDDLRDDLFELGLEYEGETEEGELRFEFEPDRLDRLSVE
1050|gene|hwa       MPIVDINMDELRSLTGHDEKSDTEFKSDLFELGLEFEGKTDTGLLQFEFGPDRLDRLSVE
2670|gene|hla       MPVVDIDTDELRGLTGRTDTSDEEFKEDLFGLGLEFEGETDEDLLQFEFAPDRLDRLSVE
3100|gene|hbo       MPVVDVHPDELRDLTGHEEKSDEEFKDDLFALGLEFEGETEDGAFQLEFGPDRLDRLSVE
                    ** *::  **** *:.  ...* ::..*** **:*:** :: . : :** .*********

2505|gene|nrc1      GIARSLRYHAGDDRGVDIPDTNAPEWAIDV-TDVPADRPYVTGAVIRGVDLDADALDSLI
12967|gene|hma      GVARSLRYHYGDDRGVEIPNTNSADWTIEV-EDQPDERPYVTGAIVRGLDMDEAALESLI
227|gene|hhi        GVARSLRYHYGDDRGVEVPNTNSADWSIEV-EDQPDERPYVTGAIVRGLDMDEAALESLI
694|gene|nph        GIARSLRYQYGHDRGIDVPKTNDAEWTITVDESVPEARPYVTGAVVRGLDLDDTQLDSLI
1676|gene|hut       GVARSLRYQYGDDWGVYVPKTNGADWTIHV-EDVPEERPYVTGAVVRGLDLDDASLDSLI
1050|gene|hwa       GVARSLRYHYGDDRGIAVPSTNNPEFQFIVTDTVPTRRPYVTGAIARGVSLDKHALDSLI
2670|gene|hla       GVARSLRYHYGDDRGVYVPETNDPEWTIEVDESVPDERPYVTGAVIRGVDLDEGALDSLI
3100|gene|hbo       GVARSLRYQYGDARGVYVPKTNDPDFTFVVDEDVPDERPYVTGAVIRGVDLDDDALDSLI
                    *:******: *  .*: :*.** .:: : *    *  *******: **:.:*   *:***

2505|gene|nrc1      QLQEKLHATMGRKRAKGAIGIHDLAMLKGDTVDGD-------------------------
12967|gene|hma      QLQEKLHATMGRKRAKGAIGVHDLTMLKGDSVT---------------------------
227|gene|hhi        QLQEKLHATMGRKRAKGAIGVHDLTMLKGDSVT---------------------------
694|gene|nph        QLQEKLHATMGRNRAKGAIGVHDLTMLKGGGARSD-------------------------
1676|gene|hut       QLQEKLHATMGRKRAKGAIGVHDLTMLKGGEAAD--------------------------
1050|gene|hwa       QLQEKLHATMGRKRAKGAIGIHDLTMLKGRTLDDSGVDITGGNEMVDTATDSRPTADRET
2670|gene|hla       QLQEKLHATMGRGRAKGAIGIHDLAMVKGAPLQ---------------------------
3100|gene|hbo       QLQEKLHATMGRKRAKGAIGIHDLTMLKGDALSE--------------------------
                    ************ *******:***:*:**                               

2505|gene|nrc1      -----GTAARSLTYTGIDPDGDTFVPLDDDAERTPADVLTEHPTGETYADLLADHDTYPA
12967|gene|hma      -----DETGKSITYTSADPDEATFVPLDADAEMTPSEVMASHETGQTYGDLVADFDRVPA
227|gene|hhi        -----DETGKSITYTSADPDEATFVPLDADAEMTPSEVMASHETGQTYGDLVADFDRVPA
694|gene|nph        -----GKPSKSITYRGVDPDGDRFVPLDDDAERTPAEVLDAHPTGETYGHLVDGLDRFPA
1676|gene|hut       -----DGEGKSVRYTGIDRDGDTFVPLEGDAEMTPGEVLAEHHIGEEYADLVAEYDRVPA
1050|gene|hwa       DTSATDSPTHSITYTGIEPTGDTFVPLDSNRELTPAAVLDEHPTGETYADIIADYDRYPA
2670|gene|hla       -----EGSEPSITYRGVDPDGVSFVPLDANDELTPNEVLAEHDTGQTYADLVEGLDRYPA
3100|gene|hbo       -----DSDGNSITYTGIDPEGDTFVPLDADAEMTPARVLEEHPTGQTYADLVSEYERYPA
                              *: * . :     ****: : * **  *:  *  *: *. ::   :  **

2505|gene|nrc1      IYDDIGLFSFPPVINGRRTEVTTDSRELFVELTGTDQWTIDRMCAIICYALDARGATIED
12967|gene|hma      IYDAIGLFSFPPVINGRRTEVSVDSRDLFIEMTGTNQWTIDHMCNIVCYALAARGGQVEK
227|gene|hhi        IYDAIGLFSFPPVINGRRTEVSVDSRDLFIEMTGTDQWTIDHMCNIVCYALAARGGQVEK
694|gene|nph        IYDDIGLFSFPPVINGSRTEVDTGTRDLFIELTGTDQWTIDRMLAIICYALSARGGRIES
1676|gene|hut       IYDSIGLFSFPPVVNGRRTEVSTDSRDLFIEMTGTDQWTIDHMLSIVCYALDARGGTIED
1050|gene|hwa       IYDELGLFSFPPVINGRRTEVTTDSRNLLIELTGTDQWTIDRMCTIICYALTARGATIES
2670|gene|hla       IYDELGLFSFPPVINGKRTEVTTGSRELFVELTGTDQWTIDRMCNIVCYALSARGATIEQ
3100|gene|hbo       IYDELGLFSFPPVINGRRTEVTTDSRELLVELTGTDQWTIDRMCNIICYALDARGATIEA
                    *** :********:** **** ..:*:*::*:***:*****.*  *:**** ***. :* 

2505|gene|nrc1      VTVDYPDRE---------LHRPDFAVRTKHVSHDRIETLLGVEFTTEAVVDLAERAGLDA
12967|gene|hma      VDVSYADDA-PGEYAGKTLERPDFSVRTKTVTHDRIESILGVSLDSREVVDYAERAGLDA
227|gene|hhi        VDVSYADDA-PGEYAGKTLERPDFSVRTKTVTHDRIESILGVSLDSREVIDYAERAGLDA
694|gene|nph        VAVDYGDRT---------LTRPDLSTTTKTVSHDRIETTLGVDLAGTDVVDLLERSGLDA
1676|gene|hut       VRVEYEDAP---EEYRDSLLRPDFSTKTKTVAHDRIERTLGIDLQGEDVIDLLERSGLDG
1050|gene|hwa       VNVEYPEQT---------FSRPDLTVDTKHISHDRIETILGVSFDTAEIIDLFERAGLAA
2670|gene|hla       VEVNYADGATAPSEYGAELVRPNFDTDEKSVSHDRIETLLGVDFEPEEIVDCFERAGLDA
3100|gene|hbo       VEVEYPDGT---------YVRPDFEVETKHVSHDRIETMLGVDLEPREVVDLFERSGLDA
                    * *.* :             **:: .  * ::*****  **:.:    ::*  **:** .

2505|gene|nrc1      ----------------TPTD-------DG--YDVEIPPYRVDVRHPVDVVDDLGRAYDFN
12967|gene|hma      --------------TETESD-------DGVAYDVEVPPYRVDVIHPLDIIDDIGRALGFN
227|gene|hhi        --------------SETESD-------DGVAYDVEVPPYRVDVIHPLDIIDDIGRALGFN
694|gene|nph        ---------------EADTE-------GELTYEVEIPAYRVDVLHPADIVDDVGRAFGFN
1676|gene|hut       --------------ESTETD-------GSPAYDVTIPPYRVDVLHPVDVIDDVGRAYGFN
1050|gene|hwa       TTTDTTDTAVTSNVDIDGSD-------NSPVYVVSIPPYRVDVLHPLDLIDDVGRAYGFD
2670|gene|hla       ---------------SYTLD-------EDVTYEVEIPPYRVDVLHPLDLVDDVGRAYGFD
3100|gene|hbo       DADDGADAGDGSDTTEAGGENATDAESDDLVYEVSIPPYRVDVLHPLDLVDDVGRAYGFN
                                       :           * * :*.***** ** *::**:*** .*:

2505|gene|nrc1      DLTPRYPDVNTIGGRTESSRLERSVRQALVGLGFEDLLNFNMTSEAENFDRMRLT-PDHD
12967|gene|hma      SLEPTYPDVSTVGGRHERSRLEDAARDALVGLGFEDLLNFHMTNEVENFERMNLSTPEAE
227|gene|hhi        SLEPTYPDVSTVGGRHERSRLEDAARDALVGLGFEDLLNFHMINEAENFERMGLD-PDNP
694|gene|nph        ELEPQYPDVSTVGGRHDRSRLEDAVRNTLVGLGFEDLLNFYMTSETELFDRMSLS-PDDN
1676|gene|hut       NLDPRYPAVGTIGGRHERARLEEAVRTVLVGLGFQDLLNFHLTSAEELHDRMGIE-PGVD
1050|gene|hwa       KLEPRYPDIGTVGGRHERSRLEAVTRTTLTGLGFEDLLNFHLTNKAEVYNRMRTS-PLSP
2670|gene|hla       NLEPRYPDVGTVGGRHERSRLEDAVRTSLVGLGFEDLLNFHMTSGTENYDRMNLE-AGSD
3100|gene|hbo       ELQPRYPNVGTVGGRHERSRLEDAARNSLVGLGFEDMLNFHMTSEEEVYDRMGIE-AGSE
                    .* * ** :.*:*** : :***  .*  *.****:*:*** : .  * .:**    .   

2505|gene|nrc1      A----------VGAAQPATIAEPYSQDFTILRTWALPSLAMVLETNTHHAYPQDLAEVGF
12967|gene|hma      DGNDADT----VGLADPVTIQEPYSEDYTILRTWALPSIMMVLENNTHRSYPQDLAEIGL
227|gene|hhi        DG---DV----VGQTDPVTIQEPYSEDYTILRTWALPSIMMVLENNTHRSYPQDLAEIGL
694|gene|nph        A----------VGAREPPTITEPYSEDYTVVRTWALPSLLMVLENNTHRAYPQDLAEIGL
1676|gene|hut       A----------LGGGDPVEIRNPYSEDYTVVRTWLLPSIMQVLENNTHRRYPQDLAEVGF
1050|gene|hwa       AAFNSTPDDIDLGSAPPAEITDPYSGDYTILRPWILPSLVQVLENNTHRTYPQDLAEVGV
2670|gene|hla       A----------FGGGNPVEITEPYSEEYTQLRTWAIPSLVMLLERNTHNAYPQDVAEVGF
3100|gene|hbo       V----------LGGGDTAEITGPYSEDYTILRTWALPSLMMVLENNTHRAYPQDLAEIGL
                               .*   .  *  *** ::* :*.* :**:  :** ***. ****:**:*.

2505|gene|nrc1      AAHADGDTQTGVAERRTVAAVLARNDASYEDAKARLQALCDEFAVALETPPTTHPSFIDG
12967|gene|hma      AAGLDDSENTGVAEHRTVAAALARTDASYEDAKARLQALADAFDKDLETPPTTHPSFIGG
227|gene|hhi        AAGLDDSENTGVAEHRTVAAALARTDASYEDAKARLQALADAFDKDLETPPTTHPSFIGG
694|gene|nph        VAGVDESKPTNVAEHRSVAGVVARTDASYEDAKARLQAIGSAFGVDIKTPPTDHPSFIDG
1676|gene|hut       VAQRDDGANTGVAEARHVAGALARHDVSYEDAKARLQALVADFDAELETPPTAHPSFIDG
1050|gene|hwa       VANRDDSVNTHVAERRHVAGAVARHDATYEDAKAALQAVCREFDATLQTPPTTHPSFIDG
2670|gene|hla       AAERDDSENTNVAERRHVAGAVARRDASYEAAKGRLQAVCDDFRAELETPRTEHPSFIDG
3100|gene|hbo       VAERDDSVNTRVDERRHVAGVLARHDATFEDAKARLQSLCRDFGAELKTPATDHPSFIDG
                    .*  * .  * * * * **..:** *.::* **. **::   *   ::** * *****.*

2505|gene|nrc1      RAATIEIDGQPAGVIGELHPGVIVEHDVEVPVAGFEFELDALR---
12967|gene|hma      RAAEVVLDGESVGVIGEIHPKVLVEHDLELPVAAFEFRLDALA---
227|gene|hhi        RAAEVVLDGESAGVIGEIHPKVLVEHDLELPVAAFEFRLDALE---
694|gene|nph        RTAAVVIDGEPAGVIGELHPRVLVEHDLEVPVAGFEFRLDALAD--
1676|gene|hut       RAAAVEIDGDAVGVIGEVHPAVLVEHDLELPVVAFEFDLAALQ---
1050|gene|hwa       RTAAIIINDTSVGVIGEIHPEVLVEHDLAVPVAAFEFELAALASEA
2670|gene|hla       RTAAVVIDGEVVGVIGEVHPAVLVEHDLEVPVAAFEFHLDALR---
3100|gene|hbo       RAASVVVDGENVGVVGEIHPRVLVEHDLELPVAAFEFDLDALR---
                    *:* : ::.  .**:**:** *:****: :**..*** * **