HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0434COG1530arCOG04307Ribonucleases G and Eputative Rnase E

HOG Organism Gene ID Name Annotation
cHOG0434 nrc1 VNG2627 rne putative Rnase E
cHOG0434 hmu HMUK0315 Hmuk_0315 RNA-binding protein AU-1
cHOG0434 hma RRNAC2113 hypothetical protein
cHOG0434 hwa HQ1398A ribonuclease
cHOG0434 hla HLAC0040 Hlac_40 protein of unknown function DUF402
cHOG0434 hbo HBOR27850 Hbor_27850 RNA-binding protein AU-1
cHOG0434 hut HUTA0324 Huta_0324 RNA-binding protein AU-1
cHOG0434 hvo HVO_0406 HVO_0406 Predicted ribonuclease of the G/E family
cHOG0434 nph NP0750A hypothetical protein
cHOG0434 hhi 2603 HAH_2603 RNA-binding protein AU-1
cHOG0434 hhi 4031 HAH_4031 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4031|hp|hhi         -----------------------------------MPEFRVRK-----------------
2627|chp|nrc1       ------MTRVRVRGIYATALTQLLRNA-GLDVVAASPPIRARFPDADLGAAEPHADIRMT
40|gene|hla         -------MKARVRGIYATALTEALLDA-GHEVVGASTPIRRRF-DAEFESAPPDARIATT
324|gene|hut        -MTDGESIGVQVRGIYATAITQRLVRADDVDVVQASTPIQRRF-ETTFAEEPASVTIETD
12113|hp|hma        -------MTVRVRGIYATALTRLLREA-GHEVVQASGPIEDRF-DGEFADERAAVTVTTT
2603|gene|hhi       -------MTVRVRGIYATALTQLLREA-DHEVVQASGPIEDRF-DGEFADERAAVTVVTT
750|hp|nph          -------MNVRVRGIYTTALTE-LLGG-EYDIVQASPPIQRRF-EASFPVAVADATVRTS
1398|gene|hwa       MGTDNHSVRVSVRGIYATALTKRLLDA-DYEIVQASPVIRERF-DIDFDTVYNTVTVTTT
27850|gene|hbo      --MSDDAARVRVRGIYTTAATHLLLDA-GHDVVQASEPIRARF-DAEFADGHHEVTVSTT
                                                          :  *                  

4031|hp|hhi         ------------------------------------------------------------
2627|chp|nrc1       PDRQGVGITAHGD-DHARAVRAVVADLPRDTFVWPDPVPRGAVFDAAVDHTVGGGAILDL
40|gene|hla         EDRQGVGA--HGDPDAIGTLRGLLTDTGLDALAWTDPTPPGTVCDGTVTETLGGGAVVRL
324|gene|hut        EQRLGVSI--VGTQAGVERVRDAL-DVAIDTLCWRDPTPQGAIFDGVVTETLGSGAVVDL
12113|hp|hma        DDQQGVGV--IGDHDAAAAVTDRLTELGRDTLHWSDPTPEGAIYAGTVTDTLGSGAVVDL
2603|gene|hhi       DDQQGVGV--VGDRDVAETVTDRLTEIGRDTLRWDDPTPEGAIYAGTVTETLGSGAVVDL
750|hp|nph          DDRLGAGI--AGTADAVDAVGETLSALGRDTFRWTDPAPRGAVFYGEVTETLGSGAVVDL
1398|gene|hwa       DDHQGVGI--HGTESAVRSVADVLTSCGRDTLAWDDLTPPGVIFTAQITETQGSGAICAL
27850|gene|hbo      DDRQGVGV--HGDPEAVESVTSDLTTVGIDTLSWTDSTPPGAVFDARVTDTKGSGAVCSL
                                                                                

4031|hp|hhi         ------------------------------------------------------------
2627|chp|nrc1       ----GDDRE-----------------------AYLPFGAVDDHVTDGDTLRVAIRDPAPP
40|gene|hla         RVGGGESEGDATTE------------------GYLPYGSVDDRIETGDPVRVQVRESAAP
324|gene|hut        ----GDTE------------------------GFLPFNATSAHVETDDRLRVQVAEPAAP
12113|hp|hma        ----GDGE------------------------GFLPYSSSDERVETGDTLRVQVVEASAP
2603|gene|hhi       ----GDGE------------------------GFLPYSSSDERVATGDTLRVQVVEASAP
750|hp|nph          ----GTVDGDSVE-------------------GFLPYNRVEGYVDEGDSYRVQVASPEPP
1398|gene|hwa       ----IPAENPDTESKTEPDLNDVHIPDESVATGYLPYDSTDKHIEQGDIMTVQSHRSMPP
27850|gene|hbo      ----GEAE------------------------GFLPFHETNDRIEEGDAVRVQVREAEPL
                                                                                

4031|hp|hhi         --------------------------------------------------------PDGW
2627|chp|nrc1       W--HDDRPT--ATSTITVSGALASLDRGVDALVAGAATDRA--ELARATELLDPDIPDNW
40|gene|hla         W--TDRRPE--LDGSLRAGGGLVTLEPG-SGTRVDARNDKDARELSGMLDLLGLKPPEGW
324|gene|hut        W--STDRPE--LDTTVSVRGDLATLVREASTEAAG----------PDLLDVLSVDVPDGW
12113|hp|hma        W--TDGRPV--LDTTVAVRGSLLSLVRGETASTPGTGG-------PAMLDLIAAEPRDGW
2603|gene|hhi       W--TNGRPV--LDTTVAVRGSLLSLVRGGTANRSGTGG-------PAMLDLIAAEPRDGW
750|hp|nph          W--GDARPS--LATALRIPGGLVELRRGSEGGLSET---------ARMADLLPVDPPEGW
1398|gene|hwa       WDNTDQRADAVVGTTLRANGGLATLIQGHEGVTVDTYDDEDARELAGMIELIDIDLPTGW
27850|gene|hbo      W--SDRRAS--LGTGIRADGGLATLVRGRDGVTVDTRDEAAGRELVGMTDFLSVEVPDGW
                                                                              .*

4031|hp|hhi         TTV---------------------------------------------------------
2627|chp|nrc1       GVYWEYDGADASLDARGTALDTLAARADRLEATLADA--------DGGDTPGL-VAAPDT
40|gene|hla         RAVWKPPAVDADTEELQAGLDRAVAAVEGLDDAVDAAGGAGVLDGSDSVREEP-LTRPNA
324|gene|hut        RVSWGRDADDADFAVLEAELEPLIDRAADIDDAFSAH--------DETTTTGR-IVDGRG
12113|hp|hma        GVSWESASEDASFDALAAALDAANDRAAAIDASLDGA------DAPEDCAPTR-YDEGRS
2603|gene|hhi       GVSWESVSEDASFDALAAALDAANDRSAAIDASLDGA------DAPEDCAPTR-YDEGRS
750|hp|nph          TPNWSRAADDASLEAMEAALRRASDRAETVMEAVVDA---------DRDEPGR-IVAPQA
1398|gene|hwa       GIEVNHAATQASLTALKSGLERAIDRAEDISDGAVAE---------EVTSTGR-------
27850|gene|hbo      GIEWSHAATKADMDALGAALERAVERAASIDDALSGA---------DEVEPLRCLAAPAS
                                                                                

4031|hp|hhi         ------------------------------------------------------------
2627|chp|nrc1       TLWAWFGRETRCALDDHRRTVAATMPGHHRIKAGSDAASDAVDFAEALGASVD-------
40|gene|hla         GVWVWFGRESRFALDDRRREATATMPGHHRVKAGSADASSGVDLAEALCEPDADA-----
324|gene|hut        TQWVLFGRESRFALDEDRREVTPTMPGHHRIKAGDERASAAVDFVEDLAPDLDG------
12113|hp|hma        TVWLWFGRESRFALDEVRREVTSTMPGHHRVKAGDRAASAAVDYVEALCDDPETGE----
2603|gene|hhi       TTWLWFGRESRFALDEVRREVTATMPGHHRVKAGDRAASAAVDYVEALCDDPETGE----
750|hp|nph          GAWLLFGRESRFELDEYRRQIETTMPGHHRTKAATTAASAAVDFAEALCEPDG-------
1398|gene|hwa       --WLWFGRESRFALDEIRRSVITTIHGHHRIKAAGETASAGVDLAEALCGDIGDGNVQIQ
27850|gene|hbo      GEWVWFGRESRFELDAHRREVETTMPGHHRTKAACEEASAGVDFVEAMCAPSG-------
                                                                                

4031|hp|hhi         --SFPDEVAT----------ISVVGGKVDGQLCL--------------TLTAERE-----
2627|chp|nrc1       --EFPFGAVTDQFGPSVGASIEIQHGKPDGALISLGRGEVTDRSAENARITVEREMT--G
40|gene|hla         --SFPFGVVTDAFGPAEGDALRLEHGKPDGRLITLGEATVTTVDADG-SVAVEREMT--G
324|gene|hut        --EFPFDVVTRQFGPQAGDRVAIAHGKPDGRTVSLGRGDVTERDPDG-TIRVEREMS--P
12113|hp|hma        -TDFPFAVTTRQFGPQVGGSLSLGHGKPDGRLITLGNGEVQSVDDDG-TVTIEREMS--P
2603|gene|hhi       -TDFPFAVTTRQFGPQVGGSLSLGHGKPGGRLITLGNGEVQSVDDDG-TVTIEREMS--P
750|hp|nph          --AFPFDVVTRQFGPTEGDDVTISHGKPDGRTISLGRGEVTDRDPEAESITVEREMS--G
1398|gene|hwa       HNEFPFEVVTQQFGPTEGERVELYHGKPEGHAFSLGQGEVTDWDANG-TIEVTRRISGHG
27850|gene|hbo      --EFPFDVVTRQFGPTEGDTVGIGHGKPDGRAFSLGRGEVVEWGEDG-TLSVERTLS--G
                       **  ..*          : :  **  *                   :   *      

4031|hp|hhi         -----------------------------------DGPR-------------------LV
2627|chp|nrc1       GGTYDALGVAREAGDTATTRFTEGNWWYPTVYRSEDGERKGTYLNVCTPVEVFPDAVRYV
40|gene|hla         GGSYDGLDVPREAGDIAETSLKEGRWWYPTTYRGRDGTVRGTYVNVCTPVEVFPDAARYV
324|gene|hut        GGTYDALGTKRRGGDVAVTKFTEGKWWYPTVYRGEDGDKRGTYVNVCTPVEVFPNEIRYV
12113|hp|hma        GGTYDALGVPKEAGDIAETKVKEGRWWYPTVYRDSDGEKKGTYVNVCTPVEIFPDTARYV
2603|gene|hhi       GGTYDGLGVPKEAGDIAETKVKEGRWWYPTVYRDSDGEKKGTYVNVCTPVEIFPDTARYV
750|hp|nph          GGTYDAIGVKREAGDIATTTFVEGRWWYPTVYCSADGERRGTYVNICTPLEVFPDTVRYV
1398|gene|hwa       SGTYDELGTPRESGDTAVTRVREGRWWYPTVYRSRDGEHKGTYVNICTPIECFPKSIRYV
27850|gene|hbo      GGTYDGLGTSRESGDTALTKFREGRWWYPTVYRSAAGDLKGTYVNVCTPVECFPDEVRYV
                                                        *                      *

4031|hp|hhi         EPGIL-------DVDENDENVLENAV-------PWTEDGTSVV--LDRLLPS
2627|chp|nrc1       DLHVDVIKHADGAVEIVDREELQDCVADGLVSEELAEKALSVAERVQSAVAE
40|gene|hla         DLHVDVMKHPDGTVERVDDDELRDAEAAGDVPEPLAEKARSVASALENAL--
324|gene|hut        DLHVDVVKHTDGTVERVDDDELDAAVAAGDVPEALAEKARKVASAVENAL--
12113|hp|hma        DLHVDVVKHADGAVERVDDDELDAAVERGHISEPLAERARSVAAAVKSALE-
2603|gene|hhi       DLHVDVVKHADGTVERVDDDELDAAVERGHISEPLAERARSVAAAVKSALE-
750|hp|nph          DLHVDVVKGPDGDVRRVDDDELDAAVEAGEISEPLAERAREVAAAIKKAL--
1398|gene|hwa       DLHVDVVKYPDGTVERVDDDELNTAVTAGHIPPALAEKAQSVASSLERALDK
27850|gene|hbo      DLHVDVIKHPDGTVERVDDDELDAAVEAGTIRDELAEKARSVASSLENALSK
                    :  :         *   * : *  .          :* . .*.  :.  :