HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0433arCOG04569hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0433 nrc1 VNG1042 vng1042 no entry
tucHOG0433 hmu HMUK2664 Hmuk_2664 conserved hypothetical protein
tucHOG0433 hma RRNAC0347 hypothetical protein
tucHOG0433 hwa HQ2410A hypothetical protein
tucHOG0433 hla HLAC1172 Hlac_1172 hypothetical protein
tucHOG0433 hbo HBOR17400 Hbor_17400 hypothetical protein
tucHOG0433 hut HUTA0337 Huta_0337 conserved hypothetical protein
tucHOG0433 hvo HVO_1492 HVO_1492 conserved hypothetical protein
tucHOG0433 nph NP2188A hypothetical protein
tucHOG0433 hhi 1081 HAH_1081 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


337|chp|hut       ---------------MTDGSWTERIAAERMQTDQEFADRVADSPLSSQQWGLVMTAVEFD
10347|hp|hma      ---------------MSDSNWTDRIAGERMAVDQRFNEQVKASSFSSQQWGLVMTAVEFE
1081|hp|hhi       MEQETLIPPARKHQFMSDSNWTDRIAGERMAVDQRFNEQVKASSFSSQQWGLVMTAVEFE
1042|hp|nrc1      ----------------MTADWQDRIVGARMSVDDAFADRVQASDLSRPQWGLVMTAVEFE
2188|hp|nph       -----------------MTDWQDMVVGDRMAVDSEFASRVDDSQFTRQEWGLIMTATTFE
2410|hp|hwa       -----------------MSEWTDSIVGDRMTVDREFNDRVTASEFSNQEWGLIMTATELD
1172|hp|hla       -----------------MSDWTDAIVGERMTVDNQFTDRVAASRFSSQEWGLIMTATEFE
17400|hp|hbo      -----------------MANWTDSIVGDRMTVDREFNDRIAASEFTSQEWGLIMTATEFE
                                     .* : :.. ** .*  * ..:  * ::  :***:***. ::

337|chp|hut       IDGPEDPETADLVVDARKLSSVMDEIRRIGDR-QPGSAATSD------SDGGILDSVKGA
10347|hp|hma      IENPGDPDAARIVADTSKLSSVMPEMERVANQ-GPMGGPGGDQS--GGSGGGLLSGVKDA
1081|hp|hhi       IENPGDPDAARIVADTSKLSSVMPEMERVANQ-GPMGGPGGDKS--GGSGGGLLSGVKDA
1042|hp|nrc1      FQDPDDPAAARIVADTSGLEHVLPEMETVDRQMAPGGPAGGGSG----TSSGVVDGIKNA
2188|hp|nph       IRNPEDETAATIVADTSELEGMMPQIEEV-SQMDPMSQQGGGSG----SDGGVVDSILGA
2410|hp|hwa       IENADNPETARLIADTENLSQIMPELDTVQSQMSQMGGSPRDTG--GGSGGGVVESIKGV
1172|hp|hla       IENADDSENARIVADTSSLPAIMPELENVRSQVAAMGGAPGGAGGSGGSGGGLVDSIKGA
17400|hp|hbo      IEHAGDPDQARIVADTEKLPQIMPELENVRSQMAQMGGAPSESK--SSSGGGLVDSIKGA
                  :  . :   * ::.*:  *  :: ::  :  .    .           :..*::..: ..

337|chp|hut       FGVGE------PSDQLRETAEALAEEYARALQSRLEERDRWADVCDRAQS--
10347|hp|hma      LGLSGSGG---GNKQQEEEAARLAQAYAEQLQEKLESNGRWKSVCEQAQG--
1081|hp|hhi       LGIGGSSG---GNKQQEEEAARLAQAYAEQLQEKLESNGRWKSVCEQAQG--
1042|hp|nrc1      LGLGDDGG--GDHEALATEAETLASAYADELQAHLEDEGRFDAVRQAAADAE
2188|hp|nph       LGLGDDGD---TDQEKVQAAERLVAAYADELQAHLEAEGRWDDVRAAAAENE
2410|hp|hwa       LGLGSNDN--GSDEERLEAAERLAQAYADELQSHLEAAGKWKQVRVAYQE--
1172|hp|hla       LGLGGSGGNDGPSDEELDAAERLVQEYADELQAHLEEVGKWEQVRVAYQE--
17400|hp|hbo      LGLGGGGG--GADAEQLAEAEKLVQEYADELQRHLESKGKWEQVRIAYQE--
                  :*:.               *  *.  **  ** .**  ..:  *