HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0431COG1475 COG0517KOG1764arCOG00622inosine-5'-monophosphate dehydrogenase

HOG Organism Gene ID Name Annotation
cHOG0431 nrc1 VNG0651 imd1 inosine-5'-monophosphate dehydrogenase
cHOG0431 hmu HMUK2164 Hmuk_2164 CBS domain containing protein( EC:1.1.1.205 )
cHOG0431 hma RRNAC1274 guaB2 inosine monophosphate dehydrogenase/GMP reductase
cHOG0431 hwa HQ1650A CBS domain-containing protein
cHOG0431 hla HLAC1039 Hlac_1039 putative signal transduction protein with CBS domains
cHOG0431 hbo HBOR21340 Hbor_21340 predicted transcriptional regulator, contains C- terminal CBS domains( EC:1.1.1.205 )
cHOG0431 hut HUTA2843 Huta_2843 CBS domain containing protein
cHOG0431 hvo HVO_0991 HVO_0991 imd inosine-5''-monophosphate dehydrogenase
cHOG0431 nph NP2318A CBS domain-containing protein
cHOG0431 hhi 1865 guaB3 CBS domain-containing IMP dehydrogenase/putative signal transduction protein
MUSCLE (3.6) multiple sequence alignment


2843|gene|hut       -------MMASSEESLTVEDYMTHEVSTVAPDDTVADVASRIADSGGHTGFPVCHDRDVQ
651|gene|nrc1       ---MDEALAHANGETPAVGDYMTRDVATVSADDTVSDVAARISESDHN-GFPVTDGRHVE
2318|gene|nph       --MDAPDDGLDSRDKPKVDDYMTRDVATVSPDDTVEDVAQRIADSDSHSGYPVCDGRTVD
11274|gene|hma      ---------MEDSNRPTVGDYMTREVATVELDDTVGEVARRIADNDHFSGFPVTDGRRVE
1865|gene|hhi       MPSVENIAPMEESSRPTVGDYMTREVATVELDDTVGEVARRIADNDHFSGFPVTDGRRVE
1039|gene|hla       -----------MSGKPTVGEYMTRDVETVSPDETVKAVAQRMAESNGHNGFPVTQGRTVE
1650|gene|hwa       -----------MSEKATVNEYMTQDVQTVSPTDTVADVAHQIKNSAGHTGFPVSEGRTVE
21340|hp|hbo        -----------MNGKAAVKEYMTREVQTVSPADSVADVAKRIVESDGHNGFPVCEGRKVE
                                     * :***.:* **   ::*  ** .: :.    *:**  .* *:

2843|gene|hut       GFVSASDLLLVDDDLPVTEVMSTDLMVAHPDMDLDDVARVILRSGIQRLPVLDDDGQLIG
651|gene|nrc1       GFVSARDLLLADPDELLFKVMTEDLVVAHPEMDVTDAARVILRSGIQKLPVVDDAGNLVG
2318|gene|nph       GFVSARDLLLAEDHEPIFKVMTEDIIVAHPDMKLTDAARVILRSGIQQLPVVDDAGNLVG
11274|gene|hma      GFVSARDLLLAEDHEPMFRVMTDDILVAHPDMAVQDAARVILRSGIQKLPVVDDAGHLVG
1865|gene|hhi       GFVSARDLLLAEDHEPMFRVMTDDILVAHPDMAVQDAARVILRSGIQKLPVVDDAGHLVG
1039|gene|hla       GFVSAADLLLADDEAPVFTVMSNDLIVAHPDMKVTDAARVILRSGIQRLPVVDDADNLVG
1650|gene|hwa       GVVTACDLLLVDDEAAIFTVMTEDIIVAHPDMAVVDAGRVILRSGIQKLPVVDDAGNLVG
21340|hp|hbo        GFVTARDLLLENDEAPIFTVMTEDIIVAHPDMAVNDAARVILRSGIQKLPVVDDAGNLVG
                    *.*:* **** :    :  **: *::****:* : *..*********.***:** .:*:*

2843|gene|hut       IISNADVIRSQIERATPDKVEQLLDTIEDVHDVEARQERRVVDLGDLTPTQTKVYGDELE
651|gene|nrc1       IITNADVIRSQIERATPEKVGKLMRTLETIHGVSITEERRTVTISDVVPTQGKVYADELE
2318|gene|nph       IISNADVIRSQIERATPEKVGKLKETLENIHGVEATEDRRTVELNSLTPTQTKVYTDELE
11274|gene|hma      IISNADVIRSQIERATPGKVDKLGRTLENIHGITTHEGRREVDLDDLTPTQTTVYADELE
1865|gene|hhi       IISNADVIRSQIERATPGKVDKLGRTLENIHGITTHEGRREVELDDLTPTQTTVYADELE
1039|gene|hla       IISNTDVVRSQIERATPSKVGKLMRTLEQIHGVKLREERREVRLTDLTPTQARVYADELE
1650|gene|hwa       IISNTDVVRSQIERATPEKVGKLMRTLEQIHGISVEQERRSITLDNLVPTQSRVYGDELE
21340|hp|hbo        IISNTDVIRSQIERATPEKVGKLMRTLEQIHGITIHQEHDSVELDALIPTQGRVYADELE
                    **:*:**:********* ** :*  *:* :*.:   : .  : :  : ***  ** ****

2843|gene|hut       GRMYELERGLAEPLVVIDNA-----GDLLLADGHHRTTAAAELGIEEMDAYVIVVEEPVD
651|gene|nrc1       GRRYELENGLAEPLVVIDNGSTGDDGSLLLADGHHRVMAAERAGVAEMDAYVIVLERAVD
2318|gene|nph       GRSYELENGLAEPLVVIDNA-----GELLLADGHHRVKAASRLGIEEMDAYVIVLDRRVE
11274|gene|hma      GRVYELERGLAEPLVVIDNG-----GDLLLADGHHRVKAAARLDIDEMDAYVIVLDETVE
1865|gene|hhi       GRVYELERGLAEPLVVIDNG-----GDLLLADGHHRVKAAARLDIDEMDAYVIVLDETVE
1039|gene|hla       GRKYELKRGLAEPLVVIDNG-----GTLHLADGHHRVMAAHEAGIEEMDAYVIITDPPVE
1650|gene|hwa       GRQYELERGLAEPLVTIDTA-----GALLLADGHHRVMAATEVGIDEMEAYVIIVDDPVE
21340|hp|hbo        GRKYELERGLAEPLVVINNN-----GTYILADGHHRVMAAHQLGTGQMDAYIIVVDDPIE
                    ** ***:.*******.*:.      *   *******. **   .  :*:**:*: :  ::

2843|gene|hut       LEMAKTATEEDLQSIDDITIVDYARHPLVESTQRETGSE
651|gene|nrc1       LGMARTARTEGLDSIADIDVVDYARHPLVETIERLQ---
2318|gene|nph       LGMAETARKCDLERIEDIQEVDYAHHPLVETTERLQEE-
11274|gene|hma      LGMAETAADSDLESIDDIEVVDYAHHPLVQTTERLQD--
1865|gene|hhi       LGMAETAADSDLESIDDIEVVDYAHHPLVQTTERLQN--
1039|gene|hla       LGMAKTAKKEGLDDITDIEIVDYARHPLVETTKRLQ---
1650|gene|hwa       LGMQRTAKKEGLYSIDDIEIVEYGRHPLVETTRRLQ---
21340|hp|hbo        LGMQRTAEKEGLNSIEDIDVVDYARHPLVETTHRLQRD-
                    * *  **   .*  * **  *:*..****::  *