HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0430COG1293KOG2030arCOG01695Predicted RNA-binding protein homologous to eukaryotic snRNPhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0430 nrc1 VNG1508 snp2 no entry
cHOG0430 hmu HMUK2189 Hmuk_2189 Fibronectin-binding A domain protein
cHOG0430 hma RRNAC0969 hypothetical protein
cHOG0430 hwa HQ1801A hypothetical protein
cHOG0430 hla HLAC1479 Hlac_1479 Fibronectin-binding A domain protein
cHOG0430 hbo HBOR13950 Hbor_13950 predicted RNA-binding protein, snRNP like protein
cHOG0430 hut HUTA2928 Huta_2928 Fibronectin-binding A domain protein
cHOG0430 hvo HVO_2883 HVO_2883 conserved protein
cHOG0430 nph NP2070A hypothetical protein
cHOG0430 hhi 1598 HAH_1598 fibronectin-binding A domain-containing protein
cHOG0430 hhi 4203 HAH_4203 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4203|hp|hhi        ---MAEILVFTLLAAVAAVYPVL-------PRY---KQLRVRYNLWTKGRLLFIASLILL
1508|chp|nrc1      MNQKREVTSVDLVALTAELNEYAGAKVDKAYLY-GDDLLRLKMRDFDRGRVELLVEVGET
2928|gene|hut      MDRKRELTSVDCAALAGELRAFVGAYHEKSYLY-DDDLLRLKLSGPNFGRIELLIEVDDP
10969|hp|hma       MDHKRELTSVDLAALEGELAGYEGAKLDKAYLYPEDDLVRLKLRDFDRGRVEFLIEVGDV
1598|gene|hhi      MDHKRELTSVDLAALEGELAGYEGAKLDKAYLYPEDDLVRLKLRDFDRGRVEFLIEVGDV
2070|hp|nph        MDRKRAMTSVDLAALVGELRDYTGAVVDKAYLY-GDDFVRLKMRDYDRGRIELLIEVGDP
1801|hp|hwa        MDPKQELTSVDIAALVTELRRYTGAKVDKTYRY-GDDLLRFRMRDFDRGRLELLIEVGTQ
1479|gene|hla      MDQKRELSSIDLAALVTELNRYEGAKVDKAYLY-DDDLLRLKLRDFDRGRVELMIEVGDI
13950|hp|hbo       MDPKRELTSVDLSALVTELNRYEGAKVDKAYLY-GDNLLRLRMRDFDRGRVELILEVGDV
                         :  .   *    :             *   . :*..      **: :: .:   

4203|hp|hhi        ILLSYAVSVYLQSIEQKSIEVSYLMGSITITPLLVEYTQLGAVVGIVALFSVVFLKSNVR
1508|chp|nrc1      KRAHVADPTHVPDAPGRPPNFAKMLRNRLSGADFHAVRQHG--------FDRIL---EFE
2928|gene|hut      KRVHTITPDRVPNAPERPPNFAMMLRNRLEGAQLESVEQFE--------FDRIL---QLR
10969|hp|hma       KRAHVADQSHVPDAPGRPPDFAMMLRNRLSGADLVRVEQFE--------FDRII---ELE
1598|gene|hhi      KRAHAADQSHVPDAPGRPPDFAMMLRNRLSGADLVRVEQFE--------FDRII---ELE
2070|hp|nph        KRAHVAVPEHVPDAPGRPPNFAMMLRNRIAGANFEGVEQYG--------FDRIL---TFR
1801|hp|hwa        KRIHTADPDHVPDAPERPPNFAMMLRNRLSGADLVNVEQFE--------FDRIM---ILS
1479|gene|hla      KRAHVADPENVADAPGRPPNFAKMLRNRMSGADFAGVEQYE--------FDRIL---TFE
13950|hp|hbo       KRAHTAKPEHVPDAPGRPPNFAMMLRNRLNGADFAGVEQYE--------FDRIL---TFD
                             : .   .. :.: :: .    . :    *          *. ::    . 

4203|hp|hhi        IQNEENLLEILRNLQSQENYSTLTNLIE-----DKYRPLVNHPPAPENPENLAASFKRAH
1508|chp|nrc1      FRREDADTTIVAELFGDGNIAVLDPQREVVDSLDTVR-LQSRTVAPGRDYGFPDARVNPL
2928|gene|hut      FERSDDHTTIIAELFGDGNLAVLDETDTVIDSLETVR-LQSRTVTPGSQYEFPSARFNPL
10969|hp|hma       FDREDASTTIVAELFGDGNVAVLDEYGEVIDCLETVR-LKSRTVAPGTPYEFPSARFNPM
1598|gene|hhi      FDREDASTTIVAELFGDGNVAVLDEYGEVIDCLETVR-LKSRTVAPGTPYEFPSARFNPM
2070|hp|nph        FEREDQTTLIVAELFGDGNIAVLNEDHEVIDCLDTVR-LSARTVAPGAQYGYPDERFSPL
1801|hp|hwa        FERGEEMTRIIVELFGDGNVAVVDSAGEVIQSLETVR-LKSRTVAPGAQYEFPDSRVNPL
1479|gene|hla      FEREDENTTLVAELFGQGNVAALDETGEVVGSLQTVR-LKSRTVAPGAQYEYPASRLNPL
13950|hp|hbo       FERGDEDTEIVVELFGQGNVAVLDETGEVVRSLETVR-LKSRTVAPGAQYEFPSSRLHPF
                   : . :    :: :* .: * :.:          :. * *  .. :*      .     . 

4203|hp|hhi        REDYEP-VEGWRKLAREKKRLVNYYLGRIGYRLKETAERSS-EYTNAL--LLDSDFSKQY
1508|chp|nrc1      DLSYEAFAEQMRDSDTDLVRTLATQLNFGGLYAEELCSRAGVEKTTPVADAPESTLEALF
2928|gene|hut      TVEYETFVERMRQSDADVVRTLATQLNFGGLYGEELCSRAGVPYNQAIGETTDAEFEALY
10969|hp|hma       TVDYDGFVARIKESDADLVRTLATQLNFGGLYGEELCTRAGIDYNVAVDDLDESDFERLY
1598|gene|hhi      TVDYDGFVARIKESDADLVRTLATQLNFGGLYGEELCTRAGIDYNVAVDDLDESDFERLY
2070|hp|nph        DCSYAAFAAKMDESDSDLVRTLATQLNFGGLYAEELCRRAGVEKTTDIDEATDDDYEALF
1801|hp|hwa        QVTYDRFISLMNESDTDIVRTLATQLNLGGLYAEEVCARAGIDKTTQITNTSDKIYRAIY
1479|gene|hla      DVSLGGFKRHMRESDSDVVRTLATQLNLGGLYAEEVCTRAGVEKETPIDDVTDDQLRALH
13950|hp|hbo       TVSYEGFKRRMEDSDTDVVRTLATQVNLGGLYAEEFCTRAGVEKTMEISDAGDEEYRAIY
                               .   :  * :   :.  *   :* . *:.      :    :      .

4203|hp|hhi        PSVATELGLRILRDDSLNGRPRKKVVHRY----------LRELLKVENSLLYRDLEQNTN
1508|chp|nrc1      DAS-ETLLGN-ISAGDLDPQVYYEPTDDE----------DEQGARVDVTPI--ALDER--
2928|gene|hut      DAV-NDLSTR-LREGDLDPRLYFET--------------DEQETPVDVTPV--PLVEY--
10969|hp|hma       ELI-DEMGTR-LREGDVDPRVYYETLDDGDGAGNGESGDDPDRRRIDVTPI--PLAEY--
1598|gene|hhi      ELI-DEMGTR-LREGDVDPRVYYETLDDGDGAGNGESGDDPDRRRIDVTPI--PLAEY--
2070|hp|nph        GAL-ERLREP-ILEGRTDPRLYED-----------------DGQVVDATPL--PLEEHT-
1801|hp|hwa        TAL-ESLGTQ-LQSGDFEPRLYTD-----------------DDAVIDATPF--PLEERK-
1479|gene|hla      EAL-ERIGER-LRSGDVDPRVYEEELSDDEAE-------DRDPRVVDVTPF--PLSEH--
13950|hp|hbo       DAI-QTFHDR-LKSGDFDPRVYTE-----------------DGNVVDATPF--PLKEHE-
                         :    :  .  : .   .                 :   :: : .   * :   

4203|hp|hhi        QDGLYRYDLEEQNRLLYALFSDFNR------------AVELDVYKPVGDKTKEIIRDQRR
1508|chp|nrc1      -ADLPSDAFESFNDALDDYFTNLDT----SEDEDSGETVDRPDFENEIEKQQRII-EQQE
2928|gene|hut      -EDTPGESFDSFNDALEAYFLGLEQ-----EPDEEETGSNRPDFEAEIEKQKRII-QQQE
10969|hp|hma       -EELYSESFTEFNPALDDYFFNFQR-----EEEVEGGETQRPDFEAEIEKQQRII-QQQE
1598|gene|hhi      -EELYSESFTEFNPALDDYFFNFQR-----EEEVEGGETQRPDFEAEIEKQQRII-QQQE
2070|hp|nph        AEGYDATAFEHFNGAIDAYFHRLQA----EAETETDTGDDKPDFESEIAKFERII-EQQQ
1801|hp|hwa        QQNLDVTTYDSFNGALDVYFREVDR-----NPAAEESGQTRPDFAAEIAKKQRII-EQQE
1479|gene|hla      -EGLPSVGFDSFNAAVDEYFYRLDRDGSEEGEAPADASPSRPDFEEEIGKQERIV-EQQQ
13950|hp|hbo       AEGLNSESYDTFNEALDEYFFAFDR--SAEDEPEEEPGSNRPDFEAEIEKKKRII-EQQE
                               *  :   *  .:                   :     * : *: :*. 

4203|hp|hhi        EEIDRYNDQRLTNTDISD----EYIFSDPVFLGVQYFDVLVTEAFHQKIDWH-VWLSYYE
1508|chp|nrc1      QAIEDFEAQAEAEREKAESLYGHYDLVDGLLSAVR-------QAREAGHGWQQIADTFDD
2928|gene|hut      GAIEDFEEDAEAEREKAELLYANYDLVDEVLSTVQ-------DARAAETPWDEIEATLSA
10969|hp|hma       QAIEDFEADAEVEREKAELLYANYDLVDDVLSTVQ-------AARQDDVSWDDIEAKFDE
1598|gene|hhi      QAIEDFEADAEVEREKAELLYANYDLVDDVLSTVQ-------AARQDDVSWDDIEAKFDE
2070|hp|nph        GAIEEYEKQAEVEQQKAELLYGNYDLVDEICSTVQ-------SAREEGVPWDEIETTFEE
1801|hp|hwa        GAIDDFEQRAEAERSRAELLYANYELVNEIIETIQ-------TARAEDTSWDEIRETFAM
1479|gene|hla      GAIEGFEEQAEAERERAELLYAEYDLVDEVLSTVQ-------EAREAEVPWDEIAETLDA
13950|hp|hbo       GAIEGFEQQAERERERAELLYANYELVDEVLSTVR-------SARDESVPWDEIRQTLED
                     *: ::     : . ::     * : : :   :.        *      *  :  .   

4203|hp|hhi        SFTREICRNYEINEYSDPDAEWPNDY------------SRLLYEMISNMRDWIKMMDEYL
1508|chp|nrc1      AAG-DVPGAEAFVGVNESAGMIRARIDD----------HTVTLDPSAGVEKNADRLYTEA
2928|gene|hut      GKDQGIPAAEAVRDVDGSEGTVTVQIDD----------HHIELDADTGVEKNADRLYQEA
10969|hp|hma       GADRGIAAAEAVVSLDGSEGTVTLDIDG----------TRVTVDAFTGVEKNADELYKEA
1598|gene|hhi      GADRGIAAAEAVVSLDGSEGTVTLDIDG----------TRVTVDAFTGVEKNADELYKEA
2070|hp|nph        GAERGIDAAAAVVGVDAAEGTVTIDLDD----------KEIDLDPTMGVEKNADRLYQEA
1801|hp|hwa        GAERGIDAAAAVVSVDGAEAMVTIEIDD----------MRVPVNVDVGVEKNADQRYTEA
1479|gene|hla      GAEQGIPAAETVVDVDGGEGTVTVELRGGDGEDDDGETTRIELDASAGVEVNADRLYQEA
13950|hp|hbo       GAERGIPAAEAVVDVDGAEGTVTIEIDG----------TRIEVEVDMGVEKNADRLYKEA
                   .    :     .   .   .                    :  :   .:  . .      

4203|hp|hhi        KPDVDSGVSGPPYHLDVVPEDVDGTPSNSESHVDDA--------AGGEDDSDESDDED--
1508|chp|nrc1      KR-IEEKKAGARAAIENTRADLDAVKQRRDEWEA-------------EPESEHEDDADDE
2928|gene|hut      KR-IEGKKAGAEEAIANTREQLEAVKQRREAWEASDGD------DGGDGSGETHEDDQED
10969|hp|hma       KR-IEEKKEGALAAIENTREDLEAVKERREEWEA----------DDGEDEADNDEAEDEP
1598|gene|hhi      KR-IEEKKEGALAAIENTREDLEAVKERREEWEA----------DDGEDEADNDEAEDEP
2070|hp|nph        KR-VRGKKEGAQAAIEDTREDLEDVKERRRQWEA-------------DDDEDDDADEESP
1801|hp|hwa        KR-IEEKKEGALTAIENTREELNAVKQRRDAWDR----------EDAKPDTEDNADNTET
1479|gene|hla      KR-IEGKKEGAMEAIKSTRAELEAVKERKAEWEAKEAAADETAGDGADDGEEEEDGEEYQ
13950|hp|hbo       KR-VEGKKEGAMAAIEDTREELAEVKARRDAWEE----------DDEDDDEEPEEPED--
                   *  :     *.   :  .  ::  .  .   .               .   :        

4203|hp|hhi        ------------------------------KQEEYGDHVRLGRMSTG---RGQRNIPEMT
1508|chp|nrc1      V------------------AWLSRSSIPIRHQEQWYERFRWFRTSEGFLVIGGRDAGQNE
2928|gene|hut      V------------------DWLTRESIPIRTSEEWYERFRWFTTSDGFLVIGGRNADQNE
10969|hp|hma       T------------------DWLSMQSIPTRSTERWYEQFRWFHTSDGFLVIGGRDADDNE
1598|gene|hhi      T------------------DWLSMQSIPTRSTERWYEQFRWFHTSDGFLVIGGRDADDNE
2070|hp|nph        DR-----------------DYLSMASVPVRYDEKWYEQFRWFRTSDDFLVIGGRDADQNE
1801|hp|hwa        VTDKVNTGTEPSRMGPTDDEWLSMTSIPLQKNDDWYEQFRWFHTSTGYLVVGGRNADQNE
1479|gene|hla      T------------------DWLSRSSIPIRSPDDWYDRFRWFYTSTGYLVIGGRNADQNE
13950|hp|hbo       I------------------DWLSRSSIPLKTEEQWYEQFRWFHTSDGYLVIGGRNADQNE
                                                   : : :..*    * .    * *:  :  

4203|hp|hhi        VIILFSCHEKILSTSEIPLQFKAYITKIVFMCLLDLREYEQGSLQW------EYSEFMLY
1508|chp|nrc1      ELV-----KKYMDRYDRFFHSQAHGGPITVLKTSAPSE-PSNDIEVPERDARQAARFAVA
2928|gene|hut      ELV-----KKYLDRGDLFFHTQAHGAPATILKATGPSEAPPDDISIPESSREEAAQFAIS
10969|hp|hma       ELV-----QKYLEGGDKFFHAQAHGGPVTVLKATGPSE-PSKEVEFPQSSLDQAAQFAVS
1598|gene|hhi      ELV-----QKYLEGGDKFFHAQAHGGPVTVLKATGPSE-PSKEVEFPQSSLDQAAQFAVS
2070|hp|nph        ALV-----KKYMDPSDRFFHAQAHGGPVTILKATAPDE-PAREVDIPDTSKREAAQFAVS
1801|hp|hwa        TLV-----KKYLNKHDRFFHTEAHGGPITILKASGPSE-PAEPIELTAETRREVAQFAIS
1479|gene|hla      ELV-----KKYMGKHDRFFHTQAHGGPVTLLKAAGPSE-SADPVDFSEETLREVAQFAVS
13950|hp|hbo       EIV-----KKYLNKHDLFFHTQAHGGPVTVVKATGPSE-PAQEVEFPDSTKREAAQFAVS
                    ::     :* :   :  :: :*:    ..:      *     :.       : : * : 

4203|hp|hhi        CLEDNLTGRASKASYR----EVLKQVYQGEYGGQSEYGVRHE-VHVKDTQ----------
1508|chp|nrc1      CSSVWKDGRGAGDAYMVSPDQVSKTPESGEYLEKGGFAVRGDRTYFRDLSTEWAVGITCE
2928|gene|hut      YSTLWKEGKYAGDVYCVGPDQVTKTPESGEYLEKGSFAIRGDRTYYDDTPVGVAVGITCE
10969|hp|hma       YSSVWKDGKFAGDVYMVDPDQVSKTPESGEYLEKGGFAVRGDRTYFEGTPAGVAVGITCD
1598|gene|hhi      YSSVWKDGKFAGDVYMVDPDQVSKTPESGEYLEKGGFAVRGDRTYFEGTPAGVAVGITCD
2070|hp|nph        YSSVWKDGKFEGDVYEVDPDQVSKTPESGEYIEKGGFVIRGDRNYYRDMQVGVAVGIKCE
1801|hp|hwa        YSSIWKEGRYADDAYVVTPDQVSKTPESGEYIEKGSFVIRGDRTYIRDVAAEIAVGIQCA
1479|gene|hla      YSSDWKDGRGAGDAYMVEPDQVSKTPESGEYIEKGSFVIRGDRTYFEDVPCRIAVGVQCE
13950|hp|hbo       YSSIWKEGRYADDAYMVTPDQVSKTPESGEYIEKGSFVIRGDRTYFRDVEAKVLVGVQCE
                       .  *.     *     :* *   .***  :. : :* :  :  .            

4203|hp|hhi        -----MTGLVDALDDII-------------------------------------------
1508|chp|nrc1      PNTRVLGGPTDAIREQVETRIEIEPGRYAQGDAAKRIYREFRERFTDESFVRKVASPGEI
2928|gene|hut      PETRVIGGPPSAIDGQAETTIEVEPGRYAQNDIAKRLYREFKGRFADDTFVRKVASPDLI
10969|hp|hma       DETRVIGGPPAAIEGQAATSITVEPGQYAQNDIAKRLYREFKERFADETFVRKVASPDQI
1598|gene|hhi      DETRVIGGPPAAIEGQAATSITVEPGQYAQNDIAKRLYREFKERFADETFVRKVASPDQI
2070|hp|nph        PDTRVIGGPPSAIEPVAETSVRLQPGQFAQNDIAKRLYRTFRERFNDTSFVRKIASADRI
1801|hp|hwa        DETQVIGGPPSAIADRVPTMVQVRPGRYAQNDAAKLAYREFRNRFADESFVRKIASPDKI
1479|gene|hla      PVTQAIGGPPSAIVDRVATSVTLEPGMYAQNDAAMMVYRELKGRFADQSFVRKVASADQL
13950|hp|hbo       GETRVLGGPPSAIEDHVEAAVSLQPGRYAQNDAAKMVYRRFREMFEDQSFVRKVASPDKI
                        : *   *:                                               

4203|hp|hhi        --------------
1508|chp|nrc1      QKYMPPGGSRIVEE
2928|gene|hut      QEFLPAGGSRMVEE
10969|hp|hma       QEFLPPGGSRMTED
1598|gene|hhi      QEFLPPGGSRMTEE
2070|hp|nph        QEFCPPGGSERVE-
1801|hp|hwa        QEFLPPGGSDLVDE
1479|gene|hla      QEFIPAGGSDIVD-
13950|hp|hbo       QEFLPPGGSELLDN