HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0043COG3355arCOG02242Predicted transcriptional regulatortranscriptional regulator

HOG Organism Gene ID Name Annotation
cHOG0043 nrc1 VNG0142 arlR2 transcriptional regulator
cHOG0043 nrc1 VNG5075c vng5075 no entry
cHOG0043 nrc1 VNG5222c vng5222 no entry
cHOG0043 nrc1 VNG6072c arlR18 transcription regulator
cHOG0043 nrc1 VNG6454c arlR21 transcription regulator
cHOG0043 hmu HMUK3390b Hmuk_3390 transcriptional regulator, TrmB
cHOG0043 hma PNG7133b hypothetical protein
cHOG0043 hwa HQ1724A transcription regulator
cHOG0043 hla HLAC2144 Hlac_2144 transcriptional regulator, TrmB
cHOG0043 hbo HBOR18700 Hbor_18700 predicted transcriptional regulator, COG3355
cHOG0043 hut HUTA0817 Huta_0817 transcriptional regulator, TrmB
cHOG0043 hvo HVO_1360 HVO_1360 Sugar-specific transcriptional regulator TrmB superfamily
cHOG0043 nph NP4124A transcription regulator
cHOG0043 hhi 5058 HAH_5058 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1724|gene|hwa      MPAPMSEQLRQDMQCESLLECFHGLKRLDKQCFRVLTQSKEPLTVDEIAEVVDRERSTAY
18700|hp|hbo       MPDSMAEYLQADMECEGLLECIHGLKQLDKLVFRTLVESAEPLTVDEVADRVERERSTAY
817|gene|hut       MSDSISEYLKQDMECEGLLECIHGLKELDRDVFMTLTARTDPMTIDEIADAVDRERSTAY
4124|gene|nph      MANSMSEYLKQDMECEGLLECIHGLKELDKEIFQLLTETAEPMTVDEIADAVDRERSTAY
142|chp|nrc1       MPDSMAEQLRHDMTCDGLLECFHGLKQLDKGVFQALVTTNDALTVDDIAERVDRERSTAY
2144|gene|hla      MPDSLSEQLQSDMQCEGLLECFHGLKPLDRECFRVLVESDEPMTIDAVAEAVDRERSTAY
5075|chp|nrc1      MPDSMSEQLRQDMECEGLLECFHGLKELDKECFQALVEAEEPMTVDELAEAVDRERSTAY
5222|chp|nrc1      MPDSMSEQLRQDMECEGLLECFHGLKELDKECFQALVEAEEPMTVDELAEAVDRERSTAY
6072|chp|nrc1      MPDSMSEQLRQDMECEGLLECFHGLKELDKECFQALVEAEEPMTVDELAEAVDRERSTAY
6454|chp|nrc1      MPDSMSEQLRQDMECEGLLECFHGLKELDKECFQALVEAEEPMTVDELAEAVDRERSTAY
7133|hp|hma        MPDSMSEQLRRDMQCEGLLECFHGLKELDKECFRALVEAEEPLTVDELADAVDRERSTAY
5058|hp|hhi        MPDSMSEQLRRDMQCEGLLECFHGLKELDKECFRALVEAEEPLTVDELAEAVDRERSTAY
                   *. .::* *. ** *:.****:**** **.  *  *.   :.:*:* :*: *:*******

1724|gene|hwa      RSIQRLLQAGFIKKEQINYDQGGYYHVYSATNPDEIANGMQRLLNDWYAKMGQLIREFEE
18700|hp|hbo       RAIQRLLQTGFVQKEQVNYDQGGYYHVYRPTDPDEVADDMQRMLNDWYAKMGTLIQEFRD
817|gene|hut       RAVQRLLQSGFIQKEQVNYDQGGYYHVYHPTDPDQIADQMQRTLNDWYAKMGQLIGEFRE
4124|gene|nph      RSVQRLVQSGFVQKEQVNYDQGGYYHVFRPTDPDEIADDMQRMLNDWYAKMGNLIGEFRE
142|chp|nrc1       RAVQRLLSAGLIQKEQINYDQGGYYHVYEPTDPAEIADDMQRLLNDWYAKMGQLIQEFET
2144|gene|hla      RSVQRLLQTGFITKEQINYDQGGYYHVYSPTDPEKITDEMQRMLNDWYAKMGQLIQEFEE
5075|chp|nrc1      RAVQRLLQTGFIEKEQVNYEQGGYYHVYSPSDPSQITDDMQRMLNDWYAKMGQLIQEFET
5222|chp|nrc1      RAVQRLLQTGFIEKEQVNYEQGGYYHVYSPSDPSQITDDMQRMLNDWYAKMGQLIQEFET
6072|chp|nrc1      RAVQRLLQTGFIEKEQVNYEQGGYYHVYSPSDPSQITDDMQRMLNDWYAKMGQLIQEFET
6454|chp|nrc1      RAVQRLLQTGFIEKEQVNYEQGGYYHVYSPSDPSQITDDMQRMLNDWYAKMGQLIQEFET
7133|hp|hma        RAVQRLLQTGFIEKDQINYDQGGYYHVYSPTDPSQIADEMQRMLNDWYAKMGQLIQEFEN
5058|hp|hhi        RAVQRLLQTGFIEKDQINYDQGGYYHVYSPTDPSQIADEMQRMLNDWYAKMGQLIQEFEN
                   *::***:.:*:: *:*:**:*******: .::* :::: *** ********* ** **  

1724|gene|hwa      KYAENANTQSGPESGPGSDPKKGSNSGSDPNTETEVTAER
18700|hp|hbo       KY-------------------------DEEVPRAEAASSK
817|gene|hut       KY-------------------------DAETAMDSTADT-
4124|gene|nph      KY-------------------------DDPAEQAAVAEN-
142|chp|nrc1       KY-------------------------DRTDAGVQSIEG-
2144|gene|hla      KY-------------------------DRSETESATVSS-
5075|chp|nrc1      KY-------------------------EQPDSVPQSAES-
5222|chp|nrc1      KY-------------------------EQPDSVPQSAES-
6072|chp|nrc1      KY-------------------------EQPDSVPQSAES-
6454|chp|nrc1      KY-------------------------EQPDSVPQSAES-
7133|hp|hma        KY-------------------------EQSESTAPTVES-
5058|hp|hhi        KY-------------------------EQSESSAPTVES-
                   **                         .