HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0425COG1522arCOG01580transcription regulator

HOG Organism Gene ID Name Annotation
cHOG0425 nrc1 VNG1816 trh3 transcription regulator
cHOG0425 hmu HMUK1554 Hmuk_1554 transcriptional regulator, AsnC family
cHOG0425 hma RRNAC3365 trh3 transcription regulator
cHOG0425 hwa HQ2773A lrp transcription regulator
cHOG0425 hla HLAC2326 Hlac_2326 transcriptional regulator, AsnC family
cHOG0425 hbo HBOR09070 Hbor_09070 transcriptional regulator, AsnC family
cHOG0425 hut HUTA0418 Huta_0418 transcriptional regulator, AsnC family
cHOG0425 hvo HVO_2507 HVO_2507 trh transcription regulator
cHOG0425 nph NP4828A transcription regulator
cHOG0425 hhi 603 trh2 transcription regulator
MUSCLE (3.6) multiple sequence alignment


1816|gene|nrc1      MDDIDQQILDTLRRDARTPYTEIADDIGVSEGTIRNRVDQLVDDGVIERFTVSTSTGNVK
418|gene|hut        MDDLDREILSILRRDARTPYTEIADDVGTSEGTVRNRVEQLVEDGTIERFTVATQTGNVK
2326|gene|hla       MDDLDRRILSILRRDARTPYTEIADQVGTSEGTVRNRVDRMTEEGIIERFTVTTRTGNVK
4828|gene|nph       MDDLDREILAILRRDSRTPYTEIAEQVGTSEGTVRNRVERLLEEGIIERFTIATRTGNVK
13365|gene|hma      MDDLDREILSILRRDARTPYTEIADRVGTSEGTVRNRVERLVDDGVIERFTVATRTGNVK
603|gene|hhi        MDDLDREILSILRRDARTPYTEIADRVGTSEGTVRNRVERLVEDGVIERFTVATRTGNVK
2773|gene|hwa       MDNLDRRILDILRRDARTPYTEIAAQVGTSEGTVRNRVDRLTEEGIIERFTISTRTGNIK
9070|gene|hbo       MDDLDREILDILRRDARTPYTEIAEQVGTSEGTVRNRVERLTNDNVIERFTVATSTGNIK
                    **::*. **  ****:********  :*.****:****:.: ::. *****::* ***:*

1816|gene|nrc1      AMIEIGVAMDADTHVVGDRMVEWDAVDFVWQVSGEDDIVLIVDAADTSGVNDLMRRAREQ
418|gene|hut        AMIEIAVDVNVDHNALADTFVEWAEVDFVWEVSGEEDVVLIVDCTDTSEVNELITRARER
2326|gene|hla       AMIEISVEMNVDTAAVGERMVDWEEVDFVWQVSGEDDIVLVVDAVDTRAVNELISQAREM
4828|gene|nph       AMIEISVAVDVDTGDIADRMTEWREVDFVWQVSGEEDVVVVVDTTDTGTLNDLITRAREL
13365|gene|hma      AMIEVSVDVNVDTAEVSDRIADWQEVDFVWQVSGEEDIVVVVDAADTDAVNGLITQAREL
603|gene|hhi        AMIEVSVDVNVDTAEVSDRIADWQQVDFVWQVSGEEDIVVVVDAADTDAVNGLITQAREL
2773|gene|hwa       AMIEVSVKVNVNTTSISETMATWEQVDFVWQVSGEEDVVLIVDAADTRAVNQLITRAREL
9070|gene|hbo       AMIEVSVKVDVDTTEISDQMAEWNQVDFVWQVSGEEDVVLVVDAADTRAVNELITRAREL
                    ****:.* ::.:   :.: :. *  *****:****:*:*::** .**  :* *: .*** 

1816|gene|nrc1      DVVVSTRTRLILDEKLG----
418|gene|hut        DEVMGTKTRLILEERVG----
2326|gene|hla       DEVKSTKTRLILDERLG----
4828|gene|nph       DEVVSTKTRLILAERRG----
13365|gene|hma      EEVVGTKTRLILNERVG----
603|gene|hhi        EEVVGTKTRLILNERVG----
2773|gene|hwa       DEIKNTKTRLILDERLGGVSS
9070|gene|hbo       DEVKSTKTRLILDERLGRSP-
                    : : .*.***** *. *