HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0424COG2520KOG1227arCOG00033Predicted methyltransferasehypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0424 nrc1 VNG1117 vng1117 no entry
cHOG0424 hmu HMUK1954 Hmuk_1954 methyltransferase (EC 2.1.1.-)
cHOG0424 hma RRNAC1405 methyltransferase
cHOG0424 hwa HQ1624A methyltransferase
cHOG0424 hla HLAC0733 Hlac_733 protein of unknown function Met10
cHOG0424 hbo HBOR23040 Hbor_23040 methyltransferase
cHOG0424 hut HUTA0242 Huta_0242 methyltransferase (EC 2.1.1.-)
cHOG0424 hvo HVO_0929 HVO_0929 trmM predicted methyltransferase
cHOG0424 nph NP1886A hypothetical protein
cHOG0424 hhi 1988 HAH_1988 methyltransferase
MUSCLE (3.6) multiple sequence alignment


1624|gene|hwa       MSDGIPCVRVPPTAGERTRTMLAEQGLIDTLYEIDTTEDYLYIPVVDS------TAVPDQ
733|gene|hla        --MSVPCVAVERERGEAVRERLADADILDGDHEIAVDGDTIYIPVADP------EAVPAD
23040|gene|hbo      --MNVPCVRVSTDEGEATRRALADRDLVDQSYEITVHEGTLYIPVTDA------SAVEDE
1886|hp|nph         --MSVRCVRVPREDGETARGRIADADALADDYEIELDDGHLYLPIVESADEAALEAALSD
1117|chp|nrc1       --MAVPCVRVPVDDGEATRQRLADADLIDDTHAIAAADGALHIPVTDA------AAVPDA
242|gene|hut        --MAVPCVRVPREDGEATRARLAERDLIDDGHEIDVVEDAILIPIVDP------SAVPEE
11405|gene|hma      --MGVPCVRVPREAGEETRQRLAEANLVDDGYDITVVDGQLYVPVTDP------TAVPSD
1988|gene|hhi       --MGVPCVRVSREAGEETRQRLAEANLVDDGYDITVVDGQLYVPVTDP------EAVPSD
                        : ** *    ** .*  :*: . :   : *    . : :*:.:.       *.   

1624|gene|hwa       F--DIVTHVVNTRDVPTSPADKLGFDPSYERLGEIIIIDEDNHEKAREVAKAIVESDIPV
733|gene|hla        LATAIVERDAAERDRPQTPAAILGYEPSLERLGDIVIVDEDDDERAREIADAVMASDVPC
23040|gene|hbo      Y--EVVSFDVESRETQTMPADILGFEPTYERLGDVVILDEDDAERASRIADAIAESDLRA
1886|hp|nph         LDADIVDRRPAARETQTLPADILGFEPSYERLGDIAIIDEDDPERARRVANAIADSELPI
1117|chp|nrc1       L--SVVSFDAPPRRTQTTPADILGFDPSYARLGDIVIVDEDDSDRAHAIADAVVESDIPV
242|gene|hut        Y--AVVDHDSPVREGQTMPADVLGFEPSYERLGEVVIIDEDDIDRAREIAEAIMAADLPV
11405|gene|hma      F--TVVEADPPVREGQTMPADALDFDPSYERIGDVAIVDEDDDERARMIADAIMGSDLPV
1988|gene|hhi       F--VVVEADPPVREGQTMPADGLDFDPSYERIGDVAIVDEDDADRARAIADAIMDSDLPV
                        :*      *     **  *.::*:  *:*:: *:***: :.*  :*.*:  :::  

1624|gene|hwa       KTVLNRDSKVSGPHRTREWEVLAGE---------------ETETCHREYGYTFRLDIESV
733|gene|hla        ETVLNRASPIEGELRVRRWDVLAGN---------------GTETVHREYGHEFLLDVAEV
23040|gene|hbo      ETVVNRASKVKGALRVRDWDILVDDTDEELSADDQRSSAPSTETVHREYGCEFLLDIAEV
1886|hp|nph         ETVVNRASPVEGELRVREWDVLVGD---------------TTETVHREYGCAFEVDIAEV
1117|chp|nrc1       EAVLNRASKIKGEQRVREWDVIAGD---------------STETVHREYGHAFALDVAAV
242|gene|hut        ETVVNRASKVKGEQRVREWDVLAGD---------------GTEAVHREYGCEFVLDLAAV
11405|gene|hma      RAVLNRASKIKGEQRVRDWDILAGE---------------GTEVTHREYGCTFDLDLAEV
1988|gene|hhi       RAVLNRASKIKGEQRVRDWDVLAGE---------------GTEVTHREYGCTFDLDLAEV
                     :*:** * :.*  *.* *:::..:                **. *****  * :*:  *

1624|gene|hwa       YFSPRLATERHRVITQVDAHDHVIDMFAGVGPFAVPMAARGADVVAAELNENAVEYLSIN
733|gene|hla        YFSPRLATERHRVIEQVDPDEAVIDMFAGVGPYAVPMAARGAEVVACDLNERAVEYLREN
23040|gene|hbo      YFSPRLATERHRVVQQVTEGERVFDMFAGVGPFVIPMAKRGAEVVGCDLNAAAVEYLREN
1886|hp|nph         YFSPRLATERHRIVSDVEADESVFDMFAGVGPFVIPAAKRGADCVGVDLNAAAIEYLRRN
1117|chp|nrc1       YFSPRLATERHRVVEQVTAGEHVFDMFAGVGPYAVPMASAGARVVATDVNETAIDYLQAN
242|gene|hut        YFSPRLATERHRVVEQVGAGEQAFDMFAGVGPFVIPMAKEGATCVGVDVNPDAIEYLREN
11405|gene|hma      YFSPRLATERHRVTKQVGEGEQTFDMFAGVGPFAIPFAKRGASCVGTDINETAIEYLQAN
1988|gene|hhi       YFSPRLATERHRVTEQVSEGEQAFDMFAGVGPFAIPFAKRGATCVGTDINETAIEYLRAN
                    ************:  :*   : .:********:.:* *  **  *. ::*  *::**  *

1624|gene|hwa       AEQNDVDDNFTIVSGDVRTLPDS-----------YIDWADRLIMNLPHSADEFLETAIRL
733|gene|hla        AERNGVADRVTAIAGDVRGIADA-----------YADTADRLVMNLPHSADEFLETAVRL
23040|gene|hbo      ARRNGVEERVTARQGDVRDVADD-----------YEGWANRIVMNLPHSADDFLDTAVRL
1886|hp|nph         AERNSVADRITAIHGDVREVVSEPPDERSEAADSYDDWADRIVMNLPHSADEFLDTAVRL
1117|chp|nrc1       AARNGVADRVTGVAGDVREVAGE-----------YTGWADRIVMNLPHTADEFLETAVAL
242|gene|hut        ARRNDVADRITAIEGDVRETVPA-----------HADWADRIVMNLPHSADEFLETALEI
11405|gene|hma      AERNGVADRMTGICGDVREVAGE-----------YEDWADRVVMNLPHSADEFLETAVRL
1988|gene|hhi       AQRNGVADRVTGICGDVREVAGE-----------YEDWADRVVMNLPHSADEFLETAVRL
                    * .*.* :..*   ****                : . *:*::*****:**:**:**: :

1624|gene|hwa       AGDECMIHYYDIQHEDTLYQPGIEAIRSAAEPNYKLTVETRHEVRSYAPHEYNICLDVRL
733|gene|hla        AGDDCAIHYYDIQHEDDPFGPGRRAIEAAAGDEYDAVVETERVVKSYAPHEYNVCLDVRL
23040|gene|hbo      AGEECVLHYYDIQHEDDPFGPGIEAIREAAEPQYDVRVDTERVVRSYAPHEYNVCVDVTL
1886|hp|nph         AGNDCLLHYYDIQHDSDPFGPGERAIREAAAPEYDVDIETRREVRSYAPHELNVCLDVRL
1117|chp|nrc1       AGDECTLHFYDIQHEDGRFDAGEAAIRAAARPAYDVTVATRHTVRSYAPHEFNVVLDVSL
242|gene|hut        AGEEAVVHYYDIQHEDDPFGPGERAIREAAGDEYDVTVETRHTVRSYAPHELNVVLDVRL
11405|gene|hma      AADECVVHYYDIQHEDDLFGPGEKAIRAAAEPAYDVTVETRHTVRSYAPKEHNIVLDVRL
1988|gene|hhi       AADDCVFHYYDIQHEDDLFGPGERAIRAAAEPAYDVTVETRHTVRSYAPKEHNVVLDVRL
                    *.::. .*:*****:.  : .*  **  **   *.  : * . *.****:* *: :** *

1624|gene|hwa       QRR
733|gene|hla        IRR
23040|gene|hbo      TAR
1886|hp|nph         TR-
1117|chp|nrc1       SRR
242|gene|hut        SR-
11405|gene|hma      TR-
1988|gene|hhi       TR-