HOG Organism Gene ID Name Annotation
aHOG4233 hwa HQ2796 uspA stress response protein
aHOG4233 nrc1 VNG1752 vng1752 no entry
MUSCLE (3.6) multiple sequence alignment


2796|gene|hwa      MFNRILLPTDGTDAMQTVIDHAIDIASRRDAVIHILYVVDDRAFLTLQDGMKADVIAELE
1752|chp|nrc1      MYDRILLPVDDSDSMDRVVEHAADVAGRRDATVDVLYVLDDRAFLTLDDGMQDEATAQLR
                   *::*****.*.:*:*: *::** *:*.****.: :***:********:***: :. *:* 

2796|gene|hwa      AEGETALEATARLFDDSDIKTTTALRKGDPADEIISYATETDVDLITMGTRRADYTENLV
1752|chp|nrc1      TQGERAVEHAADRLSEAGVDTETYVRDGDPADEILAVLAEDGADLVVMGTRRGDFEQSML
                   ::** *:* :*  :.::.:.* * :*.*******::  :* ..**:.*****.*: :.::

2796|gene|hwa      GSVSQSIVARADTPVLTTNLTRDDDI
1752|chp|nrc1      GSVSRDVVESTETPVLTVPVTED---
                   ****..:*  ::*****. :* *