HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0423COG0537KOG3379 KOG3275arCOG00419Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolaseshistidine triad protein

HOG Organism Gene ID Name Annotation
cHOG0423 nrc1 VNG1864 hit2 histidine triad protein
cHOG0423 hmu HMUK1511 Hmuk_1511 histidine triad (HIT) protein( EC:3.6.1.17 )
cHOG0423 hma RRNAC3423 hit1 histidine triad protein
cHOG0423 hwa HQ3207A hit histidine triad (HIT) hydrolase ( bis(5'-nucleosyl)-tetraphosphatase (asymmetrical))
cHOG0423 hla HLAC2053 Hlac_2053 histidine triad (HIT) protein
cHOG0423 hbo HBOR09750 Hbor_09750 HIT family hydrolase, diadenosine tetraphosphate hydrolase-like( EC:3.6.1.17 )
cHOG0423 hut HUTA0074 Huta_0074 histidine triad (HIT) protein
cHOG0423 hvo HVO_2601 HVO_2601 hit histidine triad protein
cHOG0423 nph NP3194A hit_1 histidine triad (HIT) hydrolase 1 ( bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) )
cHOG0423 hhi 651 hit1 histidine triad protein
MUSCLE (3.6) multiple sequence alignment


2053|gene|hla       MDRIYAPWRIEWVERDAD-------PIEG--CPFCVLPERED--ARDARVVARSERNYVL
3194|gene|nph       MDQVFAPWRIKWVEREDK-----NEAIDG--CPFCVLPERDD--ASESLVVAESEHAFVL
3207|gene|hwa       MEQVFAPWRIEWVERDET------ESIDG--CPFCVLPARKPTRDRESRIVARSQHSFVL
74|gene|hut         MDQVFAPWRIEWVERSEK------NPDVD-ACIFCELPGWDD--DRTNRLIAENDHAYVL
1864|gene|nrc1      MEQVFAPWRIEWVERDDT-----TDDDVD--CVFCAFPGREH--ARQHLVVARTDHAAVM
13423|gene|hma      MDKVFAPWRIEWVEREKT------NPDVD--CVFCAFQAQDD--DRANNLVARSDHAFVL
651|gene|hhi        MDKVFAPWRIEWVEREET------NPDVD--CVFCAFRAGDD--DRANNLVARSDHAFVL
2601|gene|hvo       MDQLFAPWRIEWVARDDDQDADADDPDDDDRCPFCALPERDD--DRESKIVARSPHSFVL
9750|gene|hbo       MDQIFAPWRIEWVERDGE-----SDADGGDACPFCALPDADD--DRENRVVARSDHSFVL
                    *:.::*****:** *.            .  * ** :   .        ::* . .  *:

2053|gene|hla       LNNAPYNPGHAMVIPREHREDPTDLDDATLLDHAKLKAATLAAMRRDVDPDGVNTGQNLG
3194|gene|nph       LNNYPYNPGHAMVIPRPHVGEYPELEPDVLFDHARLKQRTIEALNAAFEPDGINAGLNLG
3207|gene|hwa       LNNYPYNPGHVMVIPDHHTGSWDALNDTELLDHARTKTATINAIQSAFDPDGINTGENLG
74|gene|hut         LNNYPYNPGHAMVIPRTHTGAYGDLDDEELLAHAHLKQRTIDAMDAAFDPDGYNVGLNLG
1864|gene|nrc1      LNNYPYNPGHCMVIPDVHTGDYGDLDADTLLDHARLKQATLDALDAALGPDAFNTGLNLG
13423|gene|hma      LNNYPYNPGHVMVIPHTHTGEYGDLDDKTLLDHGRLKQRTFDALETALSPDAFNAGLNLG
651|gene|hhi        LNNYPYNPGHVMVIPHTHTGEYGDLDDETLLDHARLKQRTFDALETALSPDAFNAGLNLG
2601|gene|hvo       LNNYPYAPGHVMVIPHRHTGEFAALSDAELLDHARLKSKTLAALDAAFDPAGFNAGENLG
9750|gene|hbo       LNNYPYNPGHVMVIPYRHSGSWSDLSDEELLDHARLKARTVDALNDALGPDAANAGENLG
                    *** ** *** ****  *      *.   *: *.. *  *. *:   . * . *.* ***

2053|gene|hla       ASAAGGSI-DHLHTHVVPRWNGDTNFMPVTGDTKVIVEAIDRTYEHLHAGFAA-------
3194|gene|nph       -EASGGSIDDHLHTHLVPRWHGDTNFMPVCSDTKVIVQAVEETHEQLMEAFAA-------
3207|gene|hwa       GDAAGGSIDDHLHTHLVPRWRGDTNMMPIINGTKVIVEALDDTYDRLHDAFTTLQPAVDT
74|gene|hut         GSAAGGSIDDHLHTHVVPRWEGDNNFMAVVSETKVIVEALEDSYERLHDAFAD-------
1864|gene|nrc1      GGAAGGSIGDHLHTHVVPRWNGDTNFMPVISDTKVIVEALDDTYDRLHDAFLA-------
13423|gene|hma      GSAAGGSIDDHLHTHVVPRWNGDTNFMPVISDTKVIVEAVEETYDRLYAAFAS-------
651|gene|hhi        GSAAGGSIDDHLHTHVVPRWNGDTNFMPVISDTKVIVEAVEETYDRLYAAFAS-------
2601|gene|hvo       GSAAGGSIDDHLHTHVVPRWNGDTNFMPVISDTKVLVQALDDSYDQIHEAFAG-------
9750|gene|hbo       GGASGGSIEDHLHTHIVPRWNGDTNFMPVIGDTKVIVEALDDTFDRLHEAFAA-------
                      *:**** ******:**** **.*:*.: . ***:*:*:: :.:.:  .*         

2053|gene|hla       ---------------------------GDDVVDPGDVEAGDAVKLDFDV-----
3194|gene|nph       ---------------------------QPDT-EPLD---SGAVFVDI-------
3207|gene|hwa       SHQMTDTENKQQETRNMGNNADHTSAMQQDADAEAS---NQAVTLRFDSHEISS
74|gene|hut         ---------------------------QSGAIVTDP---DDAISFS--------
1864|gene|nrc1      ---------------------------RPDATEAPT----GAVFVDFN------
13423|gene|hma      ---------------------------QDGTTAPED----GAVRIE--------
651|gene|hhi        ---------------------------QDGTTAPED----GAVRIE--------
2601|gene|hvo       ---------------------------LDGALADGD---DDAVRFELD------
9750|gene|hbo       ---------------------------QEGASVDGS---NDAVELDFEFPSDS-
                                                 ..          *: .