HOG Organism Gene ID Name Annotation
aHOG4223 hla HLAC0301 Hlac_301 hypothetical protein
aHOG4223 nph NP1446 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


301|hp|hla       MIDIDATLRDAFEHTDYDLGDVAVNRKQVRVPVLQQGADPDALTAVIEEALGADAVVAAT
1446|hp|nph      MDDIVATVRETLEADGYTVNSAGVNRGQVRVSLLEADASAAALRELVTDAVGESAVVGLS
                 * ** **:*:::*  .* :....*** ****.:*: .*.. **  :: :*:* .***. :

301|hp|hla       VTTEAIDGEDTIGTVVSFRYQP-
1446|hp|nph      VANEAPEGEDDVRTVITFRYRDA
                 *:.** :*** : **::***.