HOG Organism Gene ID Name Annotation
aHOG4221 hla HLAC1238 Hlac_1238 formate dehydrogenase, alpha subunit
aHOG4221 nph NP3710 fdhA_2a formate dehydrogenase 2, alpha subunit (nonfunctional, N-terminal part, interrupted by ISH)
MUSCLE (3.6) multiple sequence alignment


1238|gene|hla      MSTEGDEPVKTICPYCGVGCGIKVNQG-DDPGDVSFMPWGEAPVNEGRVCIKGGAATQVV
3710|gene|nph      MSSDPSEPTETICPYCGVGCGIKITQDTDDPGDVQFMPWGEAPVNEGRVCIKGGAATEVI
                   **:: .**.:*************:.*. ******.**********************:*:

1238|gene|hla      DHEDRLTEPLIKEDGEFREATWEEAYSRIVSEMERIRDENDPDAMGFFGSSKTMNEENYL
3710|gene|nph      DHEDRLTEPLIKDGEEFREASWEECYEYIVAELERIRDEYGPDAMGFFGSSKTMNEGNYL
                   ************:. *****:***.*. **:*:****** .*************** ***

1238|gene|hla      LQKIARRYGTNNVDNCTRMCHASTVWALRRSLGAGAMTNSMVDLEESADVFWIQGANPGE
3710|gene|nph      FQKLARRYGTNNVDNCTRMCHASTVWALRTSLGMGAMTNSMEDIRESADLLWIQGANPGE
                   :**:************************* *** ******* *: ****::*********

1238|gene|hla      QHPIANSQYFRQAVLEGATVIQVDPHANKTTRSFKIGETDRHMHLQVNPGADIPLLNIVL
3710|gene|nph      QHPIATSQYLRQAALDGATVIQVDPHANGTTESLEVEATDRHQHLQLNPGTDIPLLNVVL
                   *****.***:***.*:************ ** *:::  **** ***:***:******:**

1238|gene|hla      KTILERHEEEPDAGWIDEAFIDERTEGFDHLKETLEDFDKEAAAEEAGVPLEDIELAAEK
3710|gene|nph      KTILDHHAEHPEDGWVDASFVESRTEGFEDLQATLDGFDAQAAAEECGVPLEDIQRAAKK
                   ****:.* * *: **:* :*::.*****: *: **:.** :*****.*******: **:*

1238|gene|hla      YAMANNAAIFTGMGMSQHTCGVDNVQNEINLALITGNLGKPGTGVNPLRGQNNVQGTSDV
3710|gene|nph      YATADNAAIFTGMGMSQHACGVDNVQNEINLALITGNVGRPGTGINPLRGQNNVQGTCDV
                   ** *:*************:******************:*.****:************.**

1238|gene|hla      GAMPNVLPGYQPVNDDEARGSVEDVWGFEVPDEPGLTNVEISHEAGHSVKGLYVMGENPI
3710|gene|nph      GVMPNVLPGYQLVDDDAARSAVEEIWGFEIPDAPGLTNVELSHEFGDSVHGLYVMGENPV
                   *.********* *:** **.:**::****:** *******:*** * **:*********:

1238|gene|hla      MSEPDGNEVEERLKSLEFMVAQDIFMTETAEFADVVLPATTWAERGGTVTNTDRRVQRMR
3710|gene|nph      MSEPDANRVAERIKDLEFMVV-----------------------------NSPRGVK---
                   *****.* * **:*.*****.                             *: * *:   

1238|gene|hla      GAEMVHENTKHDLDILMEVGSRLFSEDEFRFDDVEAVFEELREVCPIYHGMTYDALGETG
3710|gene|nph      ------------------------------------------------------------
                                                                               

1238|gene|hla      IQWPCYEEGDQGDQYLYEDSFDTESGLGHIEGVRHQPPAEVPDEEYPLILTTARLEEHYN
3710|gene|nph      ------------------------------------------------------------
                                                                               

1238|gene|hla      TGTMSRRSPTLMRQHPENFVDVHPNDAEEYGIEDGDMVTLRSRRGEIEVKAQVTEDIKEG
3710|gene|nph      ---------------PRGFL------------------------------------LQRR
                                  * .*:                                    ::  

1238|gene|hla      VVWTTPHFAAASANRLTNDVLDERAKIPEYKAAAADIAVTVSDGGERVDDAEPDAGSEPG
3710|gene|nph      ALHSQP----------------------------------------------------PG
                   .:.: *                                                    **

1238|gene|hla      DD
3710|gene|nph      EA
                   :