HOG Organism Gene ID Name Annotation
aHOG4218 hla HLAC2154 Hlac_2154 L-carnitine dehydratase/bile acid-inducible protein F
aHOG4218 nph NP6182 crotonobetainyl-CoA:carnitine CoA-transferase /alpha-methylacyl-CoA racemase 1
MUSCLE (3.6) multiple sequence alignment


2154|gene|hla      MVGEARDPDGDTGPLDGLTVLDASRVLVGPFCTMQLGDLGAEVIKIERPGEGDQTRTWRP
6182|gene|nph      MAGEARNPNGDTGPLDGLTVLDASRVLVGPFCTMQLGDLGADVIKIERPDGGDQTRAWHP
                   *.****:*:********************************:*******. *****:*.*

2154|gene|hla      PAFGEGDGAQSAYYASVNRNKRSVELNLAGEAGRAVFRDLAREADVVVENFRVGKMAEWD
6182|gene|nph      PTYGDSE--ESAYYTSINRNKRSVALNLQSDEGQAAFRELAAEADVLVENFRVGKMEEWG
                   *::*:.:  :****:*:******* *** .: *.*.**:** ****:********* **.

2154|gene|hla      LDYPDLAAENPELIYCGISGYGEWGPDRDKPAYDIMMQARGGFMSITGVDGGPPVRIGVA
6182|gene|nph      LGYETLAEENPELIFCSLSGYGEWGPDKDRPAYDIMMQAEGGLMSITGEENGPPVRVGVA
                   *.*  ** ******:*.:*********.*.********* **:***** :.*****:***

2154|gene|hla      LADIGAGMYATQAILAALLERELGDGTGQKIDVSLLDGQAAWTSYMAANYFASGEPPGRM
6182|gene|nph      IADIGAGMYATQAILAALLHRELGDGTGQKIDVSLLDGQVAWMTYMASYYFATGDPPERM
                   :****************** *******************.** :***: ***:*:** **

2154|gene|hla      GSKHPNIAPYQAFETRDGYVVVACASDAFWPRLCEALDRPDLLADDRFGTNEKRVRNRDA
6182|gene|nph      GSKHPTIAPYQAFETADGYVVIASGSEHIWPRFCIAIDREELIDDERFATNAARVEHRDE
                   *****.********* *****:*..*: :***:* *:** :*: *:**.**  ** :** 

2154|gene|hla      LDPELDAAFADLTTQDALDRLDEHGVPASPVRDMAEVFDDPQLAARNMIAEFDHPTAGPM
6182|gene|nph      LDPLLEEELRQYSTEEVLARMDEAGVPASKVRDMEDVFEHPQVQARGMHKTVSHPTIGDV
                   *** *:  : : :*::.* *:** ***** **** :**: **: **.*   ..*** * :

2154|gene|hla      RVPGSPMHFSRTPTTVRQHPPSLGEHTEAVLREYGYGDGDLNELKKRGAIPNR--
6182|gene|nph      EMPGSPMHFSETPTSIEKHPPLLGEHTEEVFEEYGLPE---------AGIPDDID
                    :******** ***:: :*** ****** *: ***  :         ..**: