HOG Organism Gene ID Name Annotation
aHOG4203 hla HLAC2560 Hlac_2560 hypothetical protein
aHOG4203 nph NP2468 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2560|hp|hla      MTSRSSPNGADRSGRTTTADGRSGRTDLDTGRAGSHTKPGEGNAERDMEATLRARLSDLG
2468|hp|nph      -MSSLGPSGLRRLALVAIVVGFV----VAVGAGTAAAEPEIEDFEFDTDDELAGAIAEYE
                   *  .*.*  * . .: . *      : .* . : ::*   : * * :  * . :::  

2560|hp|hla      V-----------------------------------------------------------
2468|hp|nph      VGGDVANVSENQNLVFELDVTEWTESENGEFIDIVDTGDFDDADASGGVITFTKTAGGED
                 *                                                           

2560|hp|hla      -------------VLVAIAVLLSFLSAAATGPASATLMGGDAATGGGDEVAPAIAADDE-
2468|hp|nph      VSAVATISLRNPTIDEATATLTVHSGEGTSEPATETVEFGEIAASFADDPVDSIGPDDET
                              :  * *.*  . . .:: **: *:  *: *:. .*: . :*..*** 

2560|hp|hla      ----------------AEPG----------------------------------------
2468|hp|nph      TLSVEADGSPAEHVVVSSPGLDGNQLESIFSVDRDHEDIGVETDGDRLLINRPADAGEQP
                                 :.**                                        

2560|hp|hla      ------------GAAR----------------------REISGSFSRPTYTGTAGDPVEI
2468|hp|nph      PVPEIEASFTHVGAANYQFVISVDRSREETVIPLEVEEPEIDVEFDEDLYEVPAGDLVTM
                             ***.                       **. .*.   *  .*** * :

2560|hp|hla      RHVIGASGNDSAYLLIGGNRLTDSGGTVGFVDVVKASGGSTTINTRLLGTN---------
2468|hp|nph      D--VSLDGLDETYLLVGADGTTAEEGVNDFLDIVKFDGGELTVNTRLLGTDAPADAVYIT
                    :. .* *.:***:*.:  * . *. .*:*:** .**. *:*******:         

2560|hp|hla      ESNVESC--SDPATNCDLEFR---NGDGDVIAKSLAELSGAAGATGASGLARPLAPQRYR
2468|hp|nph      DGTVHSYLHGDETEFDDVDFREDEEGEGDEIAASLDEYRAELDMTEQP---RPLQPDRYR
                 :..* *   .* :   *::**   :*:** ** ** *  .  . *  .   *** *:***

2560|hp|hla      LAV-TNGTFIVRNSGAVDPVKVAAESDLVLESPTFHDDVEVFTTADSDVITDGEGETESL
2468|hp|nph      IVAGAEGTVITRDDEIPDFDYPLGRSNLLLNQP---EPGEVTTHVAPQASANSVEETGSL
                 :.. ::**.*.*:.   *     . *:*:*:.*   :  ** * . .:. ::.  ** **

2560|hp|hla      GALRENGLERTAVTKGDRVVLGFESTGIWGALSYFAERRSTGAIEPGTQIDHRVLSDLLE
2468|hp|nph      NELLDELTERETVAKGDRLVFEIEATGIYGNLFAFGD-GSEPPFEEG--VHPRALGSVVD
                 . * ::  ** :*:****:*: :*:***:* *  *.:  *  .:* *  :  *.*..:::

2560|hp|hla      AEEGVSLRIRQTNPGRNERGAEFDLANADPKDVTLY-LAEGETLERGESDRAPGRFYLAI
2468|hp|nph      AHEGIIVNVSETNSDPNTAPTEIDF--NEPADGDAYVLPAHEDEELSEID----RFYVVL
                 * **: :.: :**.. *   :*:*:   :* *   * *.  *  * .* *    ***:.:

2560|hp|hla      DTSDGGPFTDDPEPGDEFAVEFALEGTDGERYAFRD---GQEPPA-AFEPKSEANDRVSE
2468|hp|nph      DTRDSGPFTRSVRHGDEFDVEFGYESPSDARHRFVDVPLGVRPPAYSIDPDLVDENPNTE
                 ** *.**** .   **** ***. *.... *: * *   *  *** :::*.   ::  :*

2560|hp|hla      QYPYHESADGRVSTEASFSVSERYLRYEHVTADRDLLIEAGNE-SITGTTSILPATELSA
2468|hp|nph      HYPYYRTSETGETDIAPFRIEDPSAEYDRTTVADELLVHNGTEVTIEGTTNVAPGTETHI
                 :***: :::   :  *.* :.:    *:..*.  :**:  *.* :* ***.: *.**   

2560|hp|hla      TIVRDGDEGPSR-TESELTIDR-GNFSVDSGLADAAPGTKASYRLYRGQSLQDSRTVLVV
2468|hp|nph      QLIAHNRTNPTRITIDEVEIDEDGSFSATEDLSTLRVGEDVEAEFYANQRLADKRAADVV
                  ::  .  .*:* * .*: **  *.**. ..*:    * ...  :* .* * *.*:. **

2560|hp|hla      SDAGDPARLRLTNGTTTNLTVTRGESLSNLSATVQNIGQLQSRERLSLDIDDGTIVEERH
2468|hp|nph      DDLDDPSEFIVTD-VGNPVTMTEGDNDTRVSATIENTGNAADRKPIEFVFEDAQIAETNR
                 .* .**: : :*: . . :*:* *:. :.:***::* *:  .*: :.: ::*. *.* ..

2560|hp|hla      VTVGPEASKNETFGEINARLEPGEYPYVLAIDGHSVNGTLTVEADPSVTRVDDAGADGGD
2468|hp|nph      -TVEPDEPAPFNF-DVPDGLEAGTYNYTVVTPDDEASGQVVVEPPEP----EEVIAAGGD
                  ** *: .   .* ::   **.* * *.:.  . ...* :.**.  .    ::. * ***

2560|hp|hla      SAAIDGAEGGDGGDGEGEADEADGDGSDDGGSDEGTSSGGGGGDAPNEELPDDEAPD--G
2468|hp|nph      DPVDDPAEPVD------------------------------------DNLPADALGELVG
                 ... * **  *                                    ::** *   :  *

2560|hp|hla      ASPTFLPFGIGTRETFGGTLLVGATYLLGHWV
2468|hp|nph      ALTSL----VGARHAVGAAVIVGGAYVLGG--
                 * .::    :*:* :.*.:::**.:*:**