HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0420COG2518KOG1661arCOG00976Protein-L-isoaspartate carboxylmethyltransferaseL-isoaspartyl protein carboxyl methyltransferase

HOG Organism Gene ID Name Annotation
cHOG0420 nrc1 VNG0089 pimT1 L-isoaspartyl protein carboxyl methyltransferase
cHOG0420 hmu HMUK0523 Hmuk_0523 Protein-L-isoaspartate(D-aspartate)O-methyltrans ferase( EC:2.1.1.77 )
cHOG0420 hma RRNAC2256 pcm2 protein-L-isoaspartate O-methyltransferase 2
cHOG0420 hwa HQ1357A pimT protein-L-isoaspartate O-methyltransferase
cHOG0420 hla HLAC0342 Hlac_342 protein-L-isoaspartate(D-aspartate) O-methyltransferase
cHOG0420 hbo HBOR26940 Hbor_26940 protein-L-isoaspartatecarboxylmethyltransferase( EC:2.1.1.77 )
cHOG0420 hut HUTA2560 Huta_2560 Protein-L-isoaspartate(D-aspartate)O-methyltrans ferase
cHOG0420 hvo HVO_0474 HVO_0474 pimT protein-L-isoaspartate O-methyltransferase 2
cHOG0420 nph NP0020A pimT_2 protein-L-isoaspartate O-methyltransferase
cHOG0420 hhi 2725 pcm2 protein-L-isoaspartate O-methyltransferase
MUSCLE (3.6) multiple sequence alignment


342|gene|hla        MDEASLRADMIEGLEHQIGETL-DEPVLTALQRVSRDPFVDDGATAAGGETGRGGGSGGN
1357|gene|hwa       MDPAVLREDMVNSVETQLDVSV-AAPVSHAMRTVPREPFVEDA--PYQNSSSEHIGT---
26940|gene|hbo      MDPAVLREDMVDGLEHGMDV---AESVALAMRTVPRHEFVEDA--PYQNRASKFEGS---
89|gene|nrc1        MEFGALREEMVDSLLDAGTALADARPADAAMRAVPRHEFVDAGHRAYTDQAFEHRGT---
2560|gene|hut       MDRAVLREDMVDGLRHRRESLLSEAAVASAMGTVPRHDFFDDDRTAYADRETERLGT---
20|gene|nph         MDPAVLRDDMVDSLEHEAKAVVRSERVSVAMRAVPREPFVEDESLAYADRTGEQLGT---
12256|gene|hma      MDPAVLRDDMVDSLQHESKGVVRSAWLSTAMRAVPREAFVGEQQ-AYSDRPFERLGT---
2725|gene|hhi       MDPAVLRDDMVDSLQHESKGVVRSAWLSAAMRAVPREAFVGEQQ-AYSDRPFERLGT---
                    *: . ** :*::.:               *:  *.*  *.     .  .      *:   

342|gene|hla        GDRSLTLATVVRLISAL-------------DAD---------------------AGDEVL
1357|gene|hwa       --TILAPSVVARLLTALHISTEPDINVQMNSPESTENPESADKSIAKGESTHETASDDVL
26940|gene|hbo      --TVLSPANVARLLTAL-------------SAE---------------------PDEDVL
89|gene|nrc1        --RVLAPSTVARLVGAL-------------EPR---------------------AGDDVL
2560|gene|hut       --RVLAPSTVARLFDAL-------------APE---------------------PDDSVL
20|gene|nph         --RVLSPSAAGRLLEAL-------------DVE---------------------PDDSVL
12256|gene|hma      --RVLSPSTAGRVLETL-------------SPE---------------------EDDDVL
2725|gene|hhi       --RVLSPSTAGRVLETL-------------SPE---------------------EDDDVL
                        *: : . *:. :*                                      .:.**

342|gene|hla        VVGAGVGYSVALLAEIAGARHIHAIDIDREAVAIARSNLSTAGYDAVLVDRRDGVNGLPE
1357|gene|hwa       VVGAGVGYTAAVLAELIDERHVHAIDINRRVVHTARSNLEVAGYEGVLVDTRDGAHGLPE
26940|gene|hbo      IVGAGVGYTAALVAEIVGDTHVHAVDIDRRLVYAARSNLQSVESAAVLVDCRDGADGLPE
89|gene|nrc1        VVGAGVGYTVAVVAEIAGPTHVHAVDIDRQVVYDARGNLADAGYEDVLVDCRDGAEGLAE
2560|gene|hut       IVGAGIGYTAALAAEIVGPERVHAVDITRRVVYEARENLATAGYDAVLVDCRDGSEGLAE
20|gene|nph         VVGAGVGYTAAVLAALTDETEVHAVDIDRRLVAAARSNLATAGYPGVLVDCRDGADGLPE
12256|gene|hma      VVGAGVGYTAAVLAEQVGAANVHAIDITRRLVIEARQNLAEAGYDAVLVDRRDGADGLPE
2725|gene|hhi       VVGAGVGYTAAVLAEHVGAANVHAIDITRRLVIEARQNLAEAGYDAVLVDRRDGAAGLPE
                    :****:**:.*: *   .   :**:** *  *  ** **  .    **** ***  **.*

342|gene|hla        YAPYDRILLEASVVKPPRALREQLAEGGRIVYPRGTAVQTIAAIEPDSGGDSADDGDDAP
1357|gene|hwa       YAPFNRILVEAASLEPPKALLNQLTANGRLVIPLGGPSQTIATVD--------AQGN---
26940|gene|hbo      YAPFDRILVEAAAIEPPNRLVSQLEPDGRLVFPMGGPKQTLVSVD--------AAGE---
89|gene|nrc1        YAPFDRVLVEAGAASVPDALARQLAADGRLVFPEGVGDQRLVSVR--------D-GE---
2560|gene|hut       YAPYDRILLEAAAVNPPRALLDQLAPDGRLVMPLGARDQTLVTVE--------G-GE---
20|gene|nph         YAPYDRILVEAAVVEPPRALLGQLADGGRLVAPLGNGAQELVAIE--------G-GE---
12256|gene|hma      YAPYDRILLEAAAIDPPRALLQQLTDDGRLVMPLGTGEQSLAVVE--------ADGS---
2725|gene|hhi       YAPYDRILLEAAAIDPPRALLQQLTDDGRLVMPLGTGEQSLAVVE--------ADGS---
                    ***::*:*:**.  . *  *  **  .**:* * *   * :. :           *.   

342|gene|hla        TGFRTTETAGPTRLQPMLVDGEQR-GVERNRTRREDAERAEQGHFARHGWEQDWIDWDDR
1357|gene|hwa       ----ILTEQGAVALDPLLVEGESGDGPARNRTVREDAEFDESGYFAPTGWEQEWIDWDKN
26940|gene|hbo      ----VVEKHGPVAFDPLLVEGEQRSGPVRNRTVREDAEFSDSGYFAPSGWEQEWIDWDER
89|gene|nrc1        ----TVGVHGPVSFAPLLVAGEQASAVERNRTVREDRERVREAAQSRPGWEREWIDWEDA
2560|gene|hut       ----VCQRHGGVAFAPLLVEGEQSGAVERNRTHREDRERAQQAAQSRTGWEQDWIDWDG-
20|gene|nph         ----RVAEYGTVAFRPLLVDGERADTVERNRTRREDREHAQRAAERRRGWEQSWIDWDRH
12256|gene|hma      -----VKRHGTVAFQPMLVEGEQADTVERNRTHREDRERARRAAQSRAGWEQEWIDWDG-
2725|gene|hhi       -----VTQHGTVAFQPMLVEGEQADTVERNRTHREDRERARRAAQSRAGWEQEWIDWDG-
                             * . : *:** **      **** *** *    .     ***..****:  

342|gene|hla        I---------
1357|gene|hwa       QQ--------
26940|gene|hbo      LSGRQRRYER
89|gene|nrc1        ----------
2560|gene|hut       ----------
20|gene|nph         R---------
12256|gene|hma      ----------
2725|gene|hhi       ----------