HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0042COG0681KOG3342 KOG0171 KOG1568arCOG01739Signal peptidase Isignal sequence peptidase

HOG Organism Gene ID Name Annotation
cHOG0042 nrc1 VNG2416 sec11 signal sequence peptidase
cHOG0042 hmu HMUK0816 Hmuk_0816 signal sequence peptidase( EC:3.4.21.89 )
cHOG0042 hma RRNAC2712 sec11a signal sequence peptidase
cHOG0042 hma RRNAC2713 sec11b signal sequence peptidase
cHOG0042 hwa HQ1002A sec11 signal sequence peptidase
cHOG0042 hla HLAC0002 Hlac_2 Signal peptidase I-like protein
cHOG0042 hbo HBOR02120 Hbor_02120 hypothetical protein( EC:3.4.21.89 )
cHOG0042 hbo HBOR09730 Hbor_09730 signal peptidase I( EC:3.4.21.89 )
cHOG0042 hut HUTA1611 Huta_1611 signal sequence peptidase
cHOG0042 hut HUTA1612 Huta_1612 Signal peptidase I-like
cHOG0042 hvo HVO_0002 HVO_0002 signal peptidase I
cHOG0042 nph NP0484A sec11 signal peptidase I (signal sequence peptidase)
cHOG0042 hhi 3 sec11b signal sequence peptidase
cHOG0042 hhi 2 sec11a signal sequence peptidase
MUSCLE (3.6) multiple sequence alignment


2|gene|hla          -MDEGDRSDGGDEPDRKTGSADSDPVNDGDFSGDDGNGGDQSVSKEDCETGPGESSETGS
1002|gene|hwa       -----------------------------------------------MTEKSGDDESPER
2120|hp|hbo         ------------------------------------------------------------
484|gene|nph        ------------------------------------------------------------
9730|gene|hbo       ------------------------------------------------------------
2416|gene|nrc1      ------------------------------------------------------------
12713|gene|hma      ------------------------------------------------------------
3|gene|hhi          ------------------------------------------------------------
12712|gene|hma      -----------------------------------------------------------M
2|gene|hhi          ------------------------------------------------------------
1611|gene|hut       ------------------------------------------------------------
1612|gene|hut       MSDPSDDRDPPDRERDRREPAPDTPSEPGDDDDDSAGNGGVADRDEQSAQDQPSAGRRER
                                                                                

2|gene|hla          ADTETPSDERGRASDDRIETGQAGSKPSRGRGETGRDRTETDRDSNSSGKGVLYRFRHN-
1002|gene|hwa       WDSEHATGIDDSGIEDDHTDSNVGLDA--RSDVNIEYNQENDRENENNPYDRARREPKH-
2120|hp|hbo         --------------------MNDDQGE--RDTTDDAPRPEPNAVSVKSSDTFLHRFLNA-
484|gene|nph        MSDRTDGGREGDPSETEPEPEGDPFEY--PAAEDRDDGDGETGDSPEGLVEWVRWFRTT-
9730|gene|hbo       ------------------MGAQDNLHP--GEPPTFCRLFADSWSMADDSGSRI-------
2416|gene|nrc1      ------------------------------------MTGDDVPDPTDGPRAAVRWFWST-
12713|gene|hma      ----------------------------------MGRDESTNSTPSGGTDESVDASPSF-
3|gene|hhi          ----------------------------------------------------MEASPAF-
12712|gene|hma      AHISVDAGRRCFSAGGELTKSGGSVRS--NNRKLIGRLRVFVVRMAGSDHRSSDGDETE-
2|gene|hhi          ------------------------------------------------------------
1611|gene|hut       -----------------------------------MIESEGEWATSARGKSAIDRFLKS-
1612|gene|hut       DSTHSPPEDRTAGTRSPLEETEPSNQP--PSGDRDHRGADSDQTGAATGRDVAERHPPSI
                                                                                

2|gene|hla          ----------------------REGPLMWIREMLSSVAIVLVIGLILFGVSGVWPPMVAV
1002|gene|hwa       ------------TAESSILTRIRRGAVTTLRETLYSVIVVVAIGLILFAISGVWPPMVAV
2120|hp|hbo         ----------------------EDGILLFVRETLVSVSAVVAIGLLLFAISGVWPPMVAV
484|gene|nph        ----------------------DDGAVVYLRDIVTSVAAVLLVGAVLFGISGIWPPMVAV
9730|gene|hbo       --------------------------PVYVRDTLQTLAAVVFVGLLLFALTGVWPPMVAV
2416|gene|nrc1      ----------------------DRADVLFVRDALSSLLVVSMVGLLLFSVSGVWPPLVAV
12713|gene|hma      ----------------------RF--GLYVRDIGTSVGAVLLVGGFLFAVSGVWPPLVAI
3|gene|hhi          ----------------------RL--ALYVRDIGTSVGAVVLVGAFLFAVSGVWPPLVAI
12712|gene|hma      ----------------------RPGGMMYVTDIVSSAGSVLLVGVLLFAVSGVWPPLVAI
2|gene|hhi          --------------------------MMYVADIVSSAGSVLLVGVLLFAVSGVWPPLVAI
1611|gene|hut       ----------------------SL--ALFAFDTLSSVLIVVMIGGLLFATSGVWSPVVAV
1612|gene|hut       DRERRKPPQRRGSASGSDSWLTRV--FQYTFDIASSVLIVVLIGALLFATSGVWPPLVAI
                                                   :   :   *  :* .**. :*:*.*:**:

2|gene|hla          ESGSMEPNIEVGDLVFVTEPGRLAPDAADND----IGVVTHEVGETADYQTFGSYGSVVI
1002|gene|hwa       ESGSMEPEMSRGDLILVSETTRFTPSYAHEN----TGVVTAEVGQSRGYQTFGGTGSVII
2120|hp|hbo         ESGSMEPHMYRGDLIFITAPDRFTPDYAYGD----TGIVTVDIGSEKGFSSFNGPGSVIV
484|gene|nph        ESGSMEPNMERGDLIFIVDNERFTPDEAISNDGSTTGVVPADVAAEHDRTKFSDHGDVII
9730|gene|hbo       ESGSMEPHIDTGDMVVVSDAGRFSGASADEH-----GIVTYAE--SDGYSRFSGKGDVIV
2416|gene|nrc1      ESGSMQPNLQKGDLVFVTEEHRLSPEYASGG----TGVVPHRTATAHGYEKIGGTGDVIV
12713|gene|hma      ESGSMEPHIDTGDMVFVMDAERFSGQEDRH------GVVTAAAGAETGYQTFQQPGDVIV
3|gene|hhi          ESGSMEPHIDTGDMVFVMDAERFSGQAARH------GVVTAAAGTETGYRTFQQPGDVIV
12712|gene|hma      ESPSMDPHIKEGDLVFVMEEDRFSGPGDHE------GVVTAAN--DDSYRAFQRPGDVIV
2|gene|hhi          ESPSMDPHIKEGDLVFVMEEERFSGPGDHG------GVVTAAN--DDSYRTFQRPGDVIV
1611|gene|hut       ESGSMQPHMDVGEFVFVMEDGRFPGPESQGD----TGIVTAHTGQEAGYRTFGGYGDVIV
1612|gene|hut       ESPSMEPNIDTGDLVFVMEEHRFSGPGATEE----SGIVPARAGQETNYRMFNGYGDVII
                    ** **:* :  *:::.:    *:.            *:*.       .   :   *.*::

2|gene|hla          YRPPG-RTTSPIIHRAMFHVEEGENWHDRADDRYHNA--ADCGELNHCPAPHDGFITLGD
1002|gene|hwa       YDPPQ-RVGSPIIHRAHFYVEDGENWYEEANSAYLTA--SGCDELRNCPAPHAGFITKGD
2120|hp|hbo         YDPPS-RAGSPIIHRARFYVEAEENWYDKANPNYINA--DSCAELRNCPAPHAGFITKGD
484|gene|nph        FLPNG-EHPIQVIHRAMLWVEDGENWYDRADPDAIGGA-ENCDELEACPAPNGGFITKGD
9730|gene|hbo       YMPPE-RTGSPIIHRARFYVESGENWYDRAAPDAIAPGIDNCDELTNCPAPNAGYITKGD
2416|gene|nrc1      YEPDGNSRAVPIIHRARFWVDNEENWYDRADESIVAA--DSCSELRNCPAPHAGFITKGD
12713|gene|hma      FEPNGNEQRTPIIHRSMLWVDAGENWYDRANREYVGNA-DSCDELRNCPAPHAGFITKGD
3|gene|hhi          FEPNGNEQRTPIIHRSMLWVDAGENWYDRANQTYVGSA-DSCDELQNCPAPHAGFITKGD
12712|gene|hma      YEPDGNSRQTPIIHRAMLWVEADENWYDRANQDYIGSA-DSCDELTSCPADHAGFITKGD
2|gene|hhi          YEPDGNSRQTPIIHRAMLWVEEDENWYDRANKDYIGSA-DSCDDLSSCPADHAGFITKGD
1611|gene|hut       YQPDGNETKTPIIHRAMFWVENGENWYERAGSTAIGNA-DSCEELANCPAPHAGFITKGD
1612|gene|hut       YQPDGNGEATPIIHRAMFWVAAEENWYDRGDPAAIGNA-DNCEELANCPAPHAGFITKGD
                    : *        :***: : *   ***:: .          .* :*  *** : *:** **

2|gene|hla          N---NGEYDQANG--L-AAPVKADWVTGVARVRVPYLGYVRLITTGQADLSDVLATSVVM
1002|gene|hwa       A---NARYDQATG--I-AGPVKRTWIRGAARFRIPYLGYVRLQLAGALT--VNPVLWVS-
2120|hp|hbo         A---NGRYDQASG--I-AEPVKTEWIDGVAHVRIPYLGYVRLELAGMFA---PMPVSAHV
484|gene|nph        D---NGDYDQVNQ--L-SDPVKPEWITGTAEVRIPYLGHIRLTFAGQPA--PPVTEPVG-
9730|gene|hbo       N---VRQYDQARG--L-ARPVKPEWVRAKAQVRVPFLGWVRLAIAGKA------------
2416|gene|nrc1      NNRSNNYYDQSAG--L-SEPVKPGWVRGTAEYRVPFAGWVRLVISGEATVARPGGAALG-
12713|gene|hma      NKVTNSKYDQVTG--A-STVVRPEWVIGTGIFRIPRLGYVRVQPSQLWH--TSVSMPVG-
3|gene|hhi          NKVTNTRYDQVTG--A-STVVRPEWVIGTGTFRIPRLGYVRVQPSQLWH--TSVSIPVG-
12712|gene|hma      N---NGRYDQVGSSPI-SEPVKPGWVVGTAEMRVPLLGQVRLQ----WN--QAGATDVGA
2|gene|hhi          K---NGRYDQVGSPPI-SEPVKPGWVVGTAEIRVPLLGQVRLQ----WN--KAGTAGEVT
1611|gene|hut       NSVTNSRYDQLME--I-SSPVKPAWIVGTAEVGVPWLGQLRLARD---------------
1612|gene|hut       N---NRYYDQVGN--QFSGPVKPEWIIGTAEYNVPGLGRVRLLTGEAQS--RYGTVAKDA
                           ***       :  *.  *: . .   :*  * :*:                  

2|gene|hla          QTGGVGADADGVSSGSGSSEKITVPDAKPIVSGGEVTAEAVA
1002|gene|hwa       --------------GIR-------------------------
2120|hp|hbo         DSVNAQTDTAPGFESTNQTVSVV-------------------
484|gene|nph        --------------ATNATSAGPQAV----------------
9730|gene|hbo       ------------------------------------------
2416|gene|nrc1      --------------GERALGQA--------------------
12713|gene|hma      --------------DVSAPAAS--------------------
3|gene|hhi          --------------GATAPAAA--------------------
12712|gene|hma      NETGLAVTNEAETAAVNATASG--------------------
2|gene|hhi          DETEPTMTNETGLTAVNGTAAG--------------------
1611|gene|hut       ------------------------------------------
1612|gene|hut       EHVTAGTTVTAATNGTESVDFPSIAP----------------