HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0419COG1989arCOG02302Type II secretory pathway prepilin signal peptidase PulO and related peptidaseshypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0419 nrc1 VNG2285 vng2285 no entry
cHOG0419 hmu HMUK0855 Hmuk_0855 Peptidase A24B, FlaK domain protein
cHOG0419 hma RRNAC2525 hypothetical protein
cHOG0419 hwa HQ1021A prepilin signal peptidase
cHOG0419 hla HLAC2136 Hlac_2136 peptidase A24A prepilin type IV
cHOG0419 hbo HBOR02510 Hbor_02510 leader peptidase family protein
cHOG0419 hut HUTA1780 Huta_1780 Peptidase A24B, FlaK domain protein
cHOG0419 hvo HVO_2993 HVO_2993 prepilin signal peptidase PulO and related peptidases transm
cHOG0419 nph NP1276A flaK preflagellin peptidase
cHOG0419 hhi 2955 HAH_2955 peptidase A24B, FlaK domain-containing protein
MUSCLE (3.6) multiple sequence alignment


1021|gene|hwa      -----------------------------MIASISDLLRLCIMPILVWAAWRDVKTRRLP
2136|gene|hla      -----------------------------MFATLPDALRLFVVPVFAWAALQDVRTRRLP
2510|gene|hbo      -----------------------------MNATLPDILRLVIVPVLGWAAWQDIETRRVP
1780|gene|hut      ------------MPTRSARANTPLAVAFGVNATLPDLLRLLVVPVFGWVAWRDVRTRRVP
1276|gene|nph      MSILHARRPRHRGFIRDSDAVCRVSSLLFGTATGPDLLRLAAVPAFAWAAYRDIETRRIP
2285|chp|nrc1      ------------------------------------------------------------
12525|hp|hma       ------------------------------------------------------------
2955|gene|hhi      -----------------------------MLGSIPDLLRLVAVPVFGWAAYRDVKTRRVP
                                                                               

1021|gene|hwa      SYLWPPLVMLGVVLLVWDTSVYF----SGLSPIYTPIAIAFLFRVSVSCLIIIPLSYGLW
2136|gene|hla      NRLWPPLYAFGALLLIWELAAIW--------PLAGFEEVRFAVRAAISLLFVAPLGYAFW
2510|gene|hbo      SVIWYPLVALGVVLLAWDTLPHL---------AFAPEDILYFVRVGISLLFVAPLSYIFW
1780|gene|hut      NRTWLPLLVLGVVLLVWDGWLVWTDGLVVDPRVFTPTPALFVFQVAFSLGLLVPLAYAFW
1276|gene|nph      NRTWLPLLAVGIIALLWDTVAVT--GFVTPTEVPTFERRRFVVQTLLSVGFVAPLGYIFW
2285|chp|nrc1      ------------------------------------------------------------
12525|hp|hma       ------------------------------------------------------------
2955|gene|hhi      NRTWTPLAVLAVVLLLWDAYTVW-------AGPTAVGQRLFFIRVAISLGFVVPLSYGFW
                                                                               

1021|gene|hwa      AIGGFGGADAKVLMTLAILIPTVPIYQFL--GMTFPVVTAPLGVFSLTILTNTVVLTAAY
2136|gene|hla      YLGAFGGADAKALIAIAILFPTFPEYAVA--GLILPLVDTQLGVFSLTVLTNTVLLALAY
2510|gene|hbo      RLGGFGGADAKALITISILVPTFPQYLLP--GLSLPTVRTTLGVFSMTILTNTVVLAVGY
1780|gene|hut      WMGGFGGADAKALIVLAILFPTYPTYLVA--DMALPAIRQPVGVFALTILSNAVLVGLAY
1276|gene|nph      RIGGFGGADAKAIITLAVAFPVYPTYYVF--QSAYPLYEAPLGVFSFTILSNAVVVGLAY
2285|chp|nrc1      -------------MVLAVLFPTYPAYEFA--GYALPGVSTTLGVFSLTVLTNTVLFALAY
12525|hp|hma       -------------MLIAVLFPIYPVYYLPMPSVALPLQQTAIGVFSLTVLSNTVLAGVVY
2955|gene|hhi      LIGGFGGADAKAFMLVAVLFPVYPVYYLPMPSVALPLQQSAIGVFSLTILSNTVLAGIVY
                                : ::: .*  * * .       *     :***::*:*:*:*:    *

1021|gene|hwa      PINLILHNITDRVWEFPAALFARPVSIDDLNTEHGQLAETSD-RITRNGIDLDALRMYLR
2136|gene|hla      PLGLAVSNLLRGERS-ATMFFARPVATDSLPDRHGRLFEDDA-GTTRNGLDLDALRMYLR
2510|gene|hbo      PLALAARNLVDGNAELPLMFLGRRIPVGSLATAHGRLFETTT-GYTRNGLDIDALRMYLR
1780|gene|hut      PLALAVRNAFGGHIG-KAMVIGRPIAAEDAVEEYGRLLETPD-GFTRRGLDLDALRMYLT
1276|gene|nph      PLVLAVRNLPRGEIT-PAMFIGRPVSVSAVTTEYGRLLETPD-GFTRGGLDIDALRMYLQ
2285|chp|nrc1      PLVLGARNALTGNVS-VVMFVGRRVAADDLATVHGSLLESSAGGFTRSGLDLDALRMYLR
12525|hp|hma       PLAVAAGNLARGRFS-LAMFIGRPVAVPDVTEEYGRLLESPD-GFDRGGLDLDALRMYLQ
2955|gene|hhi      PLAVAAGNLARGRFS-LAMFIGRPVAAANVTEEYGRLLESPD-GFDRGGLDLDALRMYLQ
                   *: :   *           ...* :.       :* * *       * *:*:******* 

1021|gene|hwa      WRGTTLSAIRESPTTHRNPASIIQTYA-PTDGAVSITPDR-----------SSVERTSAK
2136|gene|hla      WRGATLADLRENPDRFRDPDSVGETHD-PTDGGTH--VGP-----------RTDGGTVTG
2510|gene|hbo      WRGTTLSELREHPDKLRDPTSITETHE-PTDGAVG--DGM-----------AVDGGTVET
1780|gene|hut      WRGRSLSELRADPDTYRDPASLPDEPHSPGDGSIPP-DGEGPLFPDGEEMIQSEGEGTAH
1276|gene|nph      WRGSDLESLRAAPDDHRR--TVPTDPNRPGDGAIDEWDTS-----------PETGGSVAA
2285|chp|nrc1      WRDCTLADLRSDPG-LRHPDTLPDTPGDPTDGAVAT-DGS--------------------
12525|hp|hma       WRGCSLADIRADPAQRRLPTSLPAVPNDPGDGSLAT-DGGD----------SASGDVAEP
2955|gene|hhi      WRGCSLADIRADPEQHRLPTSIPAVPNDPGDGSLAT-DGGD----------SVSGDVAEP
                   **.  *  :*  *   *   ::      * **.                           

1021|gene|hwa      SHTDMRSSNLTDFDSVDATDVWGADRFLEAVNHRAYGSSPTQLRDTLTLLSAPDRQTVWV
2136|gene|hla      VDGEGGADRPG-----D--DPWAAERFLEEIDHGAYGTDAETLRGGLAVVAR--KDRVLV
2510|gene|hbo      ----------------E--DPWGAAAFLDDIDSTAYGTTPEKLRDGLQVVAS--QDEVWI
1780|gene|hut      QTDDESTPRSDGGEY-E--DPWGAEAFFADIEHSAYGTTPAELREGLEVLAD--SDTVWI
1276|gene|nph      A---------------D--DPWGAEMFLDA--HDAYGTTPEQLREGLAVLADAETEQVWI
2285|chp|nrc1      ----------------G--DPWGAAAFLADIDHSAYGTTPAQLRDGLDLITD--HDDVWV
12525|hp|hma       SANDIGADGMDHPDQID--DPWGAERFLDDIDHSAYGTSPQQLRDGLDVLVE--QDEVWI
2955|gene|hhi      SANDIGADGMDHPDHID--DPWGAERFLNDIDHSAYGTSPDQLRDGLDVLVE--EDEVWI
                                      * *.*  *:      ***: .  **  * ::     : * :

1021|gene|hwa      SPGIPFLVPICLGTVIAFTYGDILFGLVISLYM----
2136|gene|hla      SPGMPFVVPMAIGLVVSLTFGDALFAVLGAVGLV---
2510|gene|hbo      SPGIPFIVPMFVGTVIAFTYGDIVFGIVGALGLV---
1780|gene|hut      TPGIPFLVPMFGGLVVSLVAGDMLLWVLEALGIGALG
1276|gene|nph      SPGIPFIVPMFVGLVVAVTYGDVLFAVLDAFGLA---
2285|chp|nrc1      TPGVPFLLPLFAGLVVALTFGDVLFYVLDALGFAAA-
12525|hp|hma       SPGIPFLVPMFAGLVVSLTYGDVLFSLLQAVGLA---
2955|gene|hhi      SPGIPFLVPMFAGLVVSLTYGDVLFSLLQAVGLA---
                   :**:**::*:  * *::.. ** :: :: :. :