HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0418COG0668KOG4629arCOG01570Small-conductance mechanosensitive channelhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0418 nrc1 VNG1388 vng1388 no entry
cHOG0418 hmu HMUK2247 Hmuk_2247 conserved hypothetical protein
cHOG0418 hma RRNAC1105 hypothetical protein
cHOG0418 hwa HQ2562A msc mechanosensitive ion channel
cHOG0418 hla HLAC1441 Hlac_1441 mechanosensitive ion channel
cHOG0418 hbo HBOR15530 Hbor_15530 small-conductance mechanosensitive channel
cHOG0418 hut HUTA0300 Huta_0300 conserved hypothetical protein
cHOG0418 hvo HVO_1659 HVO_1659 conserved hypothetical protein
cHOG0418 nph NP4196A msc_6 mechanosensitive channel
cHOG0418 hhi 1714 mscS3 mechanosensitive ion channel
MUSCLE (3.6) multiple sequence alignment


11050|hp|hma        ------------------------------------------------MFVFDATPLIYL
1388|hp|nrc1        -------------------------MTDVLRTLVGPH----FEYGLATLVLLCGAVAGYL
300|chp|hut         ----------------------MVDIPDLIRTLFSEE----TAVVVAIFVLFIGTVLSYL
1714|gene|hhi       -------------------MQFGFDWATIIRQVFSPQ----GTFVFSLVVLAFGIVLGYL
4196|gene|nph       ------------------------MVDLPLRSWFEGLPTPGQNLLVAAGVLVAGLVAGAL
2562|gene|hwa       -------------------MWVLQSFPPVARDFVAAVP---QAIWVAILVFIASVVAAVI
15530|gene|hbo      MIPAGSMLLMQSGDRTPTSGPATSPADSFLAELYTLFP---RDVWFALIVLVAGVAVALI
1441|gene|hla       ----------------------MSAVPTPLSEFVASVP---DRIWLALFVLLFGLFAAYV
                                                                     ..  .     :

11050|hp|hma        AKAERLSLLSRLDASRLIPQRVYEEVV------TVGL---------------------DA
1388|hp|nrc1        VGWIHRRVMLAAGVDEIVEGTTVERLARRSGTTTVDLTARFVSTVVYIVAVLVALDAAQF
300|chp|hut         VWRMTHSVLEQAGIPEAVEGTVFERTLQNVGFSTVGLVAQLAAIFVYALAIFIAIQTAQL
1714|gene|hhi       VWRSSRRFMRELGVPEAVEGTPFERTARGLGTSTVGIVSNLAALFIYITTVTAVLNIAQL
4196|gene|nph       TAYLVSRALRAFGVDDAVEGTPFERTARQLGTSTVRLLARLCGLFVFVVAALYAGQVLEV
2562|gene|hwa       TGRITTRLLLQLNIPTVIEGTALERTAQEFGTSTVNLISGIVRYFIIAVGAVGSLSVTDL
15530|gene|hbo      LGTLTRRVLTGLGVPEAIEGTAFERTARNFDTSTVEILGWLVRYFVVGIAILAALSIANV
1441|gene|hla       VGAINRRLLTRAGVPEVIEGTAFERTAHEFDTSTVRILAKLSSYFILAVAVIVALTVADV
                            :   .    :     *         ** :                     : 

11050|hp|hma        GYPD--------------------------ARRIEQSVEEGTFDVVSVPETTLFDRLSGN
1388|hp|nrc1        SIQKPLWRLLGSILPSVLAAVVVVVVGVLVGDKVEVFVTE-RLRSVKFPEASVVAVAARY
300|chp|hut         NYPTQFWAGFSAYLSQLFIAALAVIAGLILGDKASLAVSE-RLRSIKLPQIYVLAPLVKY
1714|gene|hhi       TDPELYWARFTSFLPDLFIALFAVIIGLIAGDKAKLIVSE-RLRSVKMPEATVLPELVKY
4196|gene|nph       MPEEAALERISAFLPQLFVAVLVILVGLIAADKAELVVSE-RLKSIKLPEVTLIPTLVKV
2562|gene|hwa       QYGTALWQEAVQFLPRVFVALLVVLTGILIGDKVELFVDE-RLRQIKLPEITIISRLAKF
15530|gene|hbo      NYADRFWSQVVEFLPMLFFAVVILIVGIVVGDKVELLVAE-RLRGVKLPQIGIIPAAAKF
1441|gene|hla       NYLEQFWSGVAAFLPRLFVAIVVLIVGVVVGDKAELLVAE-RLRGIKLPELGVLPPLVKY
                                                  . . .  * *  :  :..*:  :.      

11050|hp|hma        PNVSDADVAVLA-LAADHGATAVMDDAYGRDIAAVEAIETRGTA-------YLVLS--LV
1388|hp|nrc1        TVVLAAGLVALSQLGVAVAALLVVFGVYLASVVVFALVATRQLLASAAAGVYLLLRQPYG
300|chp|hut         SIFYVAALVALGQLGVATTALLVLLSVYVFGILFLGGLAFKHLLAAGAAGIYLLLSEPYS
1714|gene|hhi       SIFYLAVLIALGQLGVETLALLILLGAYAFGLVFVCGLALKDILQAGAAGLYLLLTEPYS
4196|gene|nph       SILYVAALIALSQLGVATGALLILLAAYAFGVFFLGGLAFKDLLSSAAAGIYVLMTEPYS
2562|gene|hwa       TTFYIAALVALSQLGVATLALVVLLAVYLFAVVAFAAVAFVDLLKSAAVGTYLLLHQPYA
15530|gene|hbo      TVFYLASLIALSQLGVATMALVIFLAAYLFAIVFLGGIAFADMLKSGAAGTYLLLTQPYA
1441|gene|hla       SVVYVAALIALGQVGVQTLALVVLLGAYALAVVLFAALATKDLVASAAAGVFLLLRQPYG
                    . .  * : .*. :..   *  :.  .*   :  .  :             ::::     

11050|hp|hma        RDGELEADDARETLEAMLDAGWHCSPSLYSKLLSKLEELAVGGADNR--
1388|hp|nrc1        IGDQVAIGSREGVVQEVDVFVTRIEADSREYVIPNHLVFRDGIVIVHHQ
300|chp|hut         IGDEVEIGDRRGVVQEIDMFVTHVENDDAEFIVPNQRVFQSGVTRFR--
1714|gene|hhi       IGDEIVIGDQSGIVQEVDILVTRIESDGEEYIIPNKRVFNTGIVRIRG-
4196|gene|nph       IGDEVAIDGCRGIVQEVDVFVTYVEAEGEEYMIPNRKVLREGAMRVRSG
2562|gene|hwa       IGDEVEIGDTRGIVQEIDLFVTHVENEDEELIIPNTLIFKRGIVRVR--
15530|gene|hbo      IGDEIRVGDTGGIVQEVDLFVTHVEDDGEEYIVPNRKVFEEGIVRLR--
1441|gene|hla       IGDEVRVAGERGIVQEVDLFVTRIEADGEEHVVPNHSVFRDGIVLIRE-
                     ..::   .    :: :       . .  . ::.:   :  *    .