HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0416COG0494KOG4313 KOG2839 KOG2937 KOG3041 KOG3069arCOG01073NTP pyrophosphohydrolases including oxidative damage repair enzymesNTP pyrophohydrolase

HOG Organism Gene ID Name Annotation
cHOG0416 nrc1 VNG1962 mtl1 NTP pyrophohydrolase
cHOG0416 hmu HMUK1444 Hmuk_1444 NUDIX hydrolase( EC:3.6.1.13 )
cHOG0416 hma RRNAC3256 hypothetical protein
cHOG0416 hwa HQ3084A nudF ADP-ribose pyrophosphatase; Mut/nudix family protein
cHOG0416 hla HLAC2467 Hlac_2467 NUDIX hydrolase
cHOG0416 hbo HBOR05970 Hbor_05970 NUDIX family protein( EC:3.6.1.13 )
cHOG0416 hut HUTA1242 Huta_1242 NUDIX hydrolase
cHOG0416 hvo HVO_1996 HVO_1996 hydrolase NUDIX family domain protein
cHOG0416 nph NP3054A nudF_2 ADP-ribose pyrophosphatase-like protein
cHOG0416 hhi 501 HAH_0501 putative NUDIX hydrolase
MUSCLE (3.6) multiple sequence alignment


13256|hp|hma       MTIVDTLIPPLQSAPSRIRPVPAFAWTRVDFAGGDHTPSMDEELAWETLDAETAYACPGF
501|gene|hhi       ---------------------------------------MDEELTWETLGAETAYACPGF
1242|gene|hut      --------------------------------------MEDKPLTWETLSSEIAYSCDGF
1962|chp|nrc1      --------------------------------------MPTDDLAWETTATTTAYDCPGF
3084|gene|hwa      ---------------------------------MTTEDSASDTLAWQTKESEIEYSCPGF
3054|gene|nph      --------------------------------------MDKDALAWETLASERDYTCPGF
2467|gene|hla      ----------------------------------------MDDLAWETLDTDIDYRCPGF
5970|gene|hbo      -------------------------------MVDDDDTAQADELAWETTASAVEYTCPGF
                                                            . *:*:*  :   * * **

13256|hp|hma       DVVREDVRFPDGTEGAFDYVQHGESVIVLPFTADGD-VVVIEEWRQPIRRINYGLPAGTM
501|gene|hhi       DVVREDVRLPDGTEEEFDYVQHGDSVIVLPFTADGD-VVVIEEWRQPVRRVNRGLPAGTM
1242|gene|hut      DVVRETVRLPDGAEVDFDYLTESESVVILPLTPDGD-VVVIEEWREPVRRVNYGLPAGSV
1962|chp|nrc1      VIRRDETRLPDGTETDYDYLHDGPAVVVLGFTPDGDEVVLIEEWRQAVGRVNRALPAGSV
3084|gene|hwa      DVRRDDVILPDGTHTQFHSVEEPPAVVILPFTSSDD-VILIEEWRQAVGRVNRGLPAGTV
3054|gene|nph      DVIRDDVRLPNGTETEFHYVSEPPSVVILPFRPDGD-VVVIEEWRQAVGRVSYGLPAGGL
2467|gene|hla      DVRRDEVRFPDGETDGYHYVDEAPAVVVLPLTPDGD-VVVIDEWRQAVGRVNRGLPAGSV
5970|gene|hbo      DVQMDDVVLPDGTETEFHYVDEPEAVVVLPFTPDDD-VVLVEEWRQAVGRVNRGLPAGSL
                    :  : . :*:*    :  :    :*::* : ...* *::::***:.: *:. .**** :

13256|hp|hma       EDED-DDPTVAAARELREETGYEADTFDHLYTGEPANGNTDYVFHYYVARGCEAAADQNL
501|gene|hhi       EDGD-DDPTVAAARELREETGYEADTLDHLYTGEPANGNTDYVFHYYVARGCAATADQDL
1242|gene|hut      EPDD-DDRRTAVARELEEETGYEPGDVTHLTTVEPANGFSDAVFHYFLAENCTPTGEQRL
1962|chp|nrc1      EPG--ESLAAAARREFREETGYEPATIEQYATYEPANGISDAVHHYFRATDCTPTASQTL
3084|gene|hwa      ESGD-TALLDAATRELSEETGYEAGSMSKLFQTEPANGLLDTVHHYFVAHDCERTMSQQL
3054|gene|nph      ETDD-EDVIAAAHRELAEETGYEADAIEQLGTYEPANGLFDSVFHYVVAHGCRPTAEQQL
2467|gene|hla      EPEDADDLERAAARELAEETGYEADSFERLTTVEPTNGIADSVHHHFLATGCEPTAEQDL
5970|gene|hbo      ESDD-DDIAAAARRELTEETGYEAGSLEYVGSVEPANGLLNSVHHHFVARDCEPTGEQEL
                   *         *. **: ******.  .      **:**  : *.*:  * .*  : .* *

13256|hp|hma       DHNESIRVDTADFDSLVQSVRDGTLRDSRSAVGIMYYALFER--
501|gene|hhi       DHNESIRVDTADFDSLVQSVRDGTLRDSRSAVGIMYYALFER--
1242|gene|hut      DDDESIRVETTTLDGLLEAAESGALRDGRTMLGVLYYELFQG--
1962|chp|nrc1      DDDETIRVDTEPYDDLVAAVRDDDIRDGRTALGVLQHELA----
3084|gene|hwa      DENESIRVSTTEYKEIKTAVRQGEIKDGRAVTAVSQYELQS---
3054|gene|nph      DDNESITVETASFDDLRDRAAVGDLRDGRTALGVLQYAVRKDS-
2467|gene|hla      DHNESIAVETVPYDDLLEAVVDEGLRDGRTVTAVLWYELLHR--
5970|gene|hbo      DFNESIRVAVEPYDDVLTAALDGEMRDGRALHGVLRYELAERWR
                   * :*:* * .   . :   .    :.*.*:  .:  : :