HOG Organism Gene ID Name Annotation
aHOG4147 hbo HBOR23140 Hbor_23140 transposase
aHOG4147 nph NP2942 IS1341-type transposase
MUSCLE (3.6) multiple sequence alignment


23140|gene|hbo      MSAVVRRTNTFAVRPLSDADERLLLDLLDASASLWNELNYERRQQFFDGDSVWDTADYRK
2942|gene|nph       ----MRRTNTFAVRPLSDDDERLLLDLLDASASLWNELNYERRQQFFDGESVWDTADYRK
                        :************* ******************************:**********

23140|gene|hbo      QYVDVLGSATAQQVIRKNKSAWQSFFAARENGEDTAPPGYWGNEDDGRELRTYIRNDQYT
2942|gene|nph       QYVGVLGSATAQQVIRKNKSAWQSFFAARENGEDTAPPGYWGNEDDGRELRTFIRHDLYT
                    ***.************************************************:**:* **

23140|gene|hbo      LETGDRSRLEIPVGQQLKDEYGLGYHDRLRLEVAGDPKWDGEQGRLEIQYDEIDDTFRAF
2942|gene|nph       LDTGERSRVEIPVGQDLKDEYGLGYHDRLRLEVAGDPKWDGEQGRLEIQYGETDDTFRAF
                    *:**:***:******:**********************************.* *******

23140|gene|hbo      QPVTVPDSRQDSRKIEDFPEVENASRFRNSPLASEEAALDVGANNLVACTTTTGQQYLYE
2942|gene|nph       QPVTVPDSRQD------------------SPLASHEAALDVGANNLVACTTTTGEQYLYE
                    ***********                  ***** *******************:*****

23140|gene|hbo      GRDLFARFRETTDEIARLQSKLREGRYSSRRIRRLYRKRTRRRDHAQDALVRDLLERLYA
2942|gene|nph       GRGLFAHFRETTREIARLQSKLREGRYSSQRIRRLYRKRTRRRDHAQDALVRDLMERLYA
                    **.***.***** ****************.************************:*****

23140|gene|hbo      EGVATVYVGDLTDVLSTHWCAEVNAKTHQFWAFQAFIDRLSDTAEEYGITVEVRSEADTT
2942|gene|nph       EGVDTVYVGDLTDVLSTHWCAEVNAKTHQFWAFRAFIERLSHTAEEYGITVEVRSEADTT
                    *** *****************************.***:*** ******************

23140|gene|hbo      RTCPVCGEQDDTDRDGDVFRCPCGHEAHADLCASRTFLERQAGKIKVGSMARPVRLKWDD
2942|gene|nph       RTCPACGEQDDTDRDGDVFRCPCGHEAHADLCASRTFLERQTGK-PVGSMARPVRLKWDD
                    ****.************************************:**  **************

23140|gene|hbo      HNWSEIPHSPERESPNEKRTNQSTS--DGKIASVDAA
2942|gene|nph       HNWSEIPHSPERARPNEKRTNQSTDSQDGKLASVGTA
                    ************  **********.  ***:***.:*