HOG Organism Gene ID Name Annotation
aHOG4145 hbo HBOR13070 Hbor_13070 hypothetical protein
aHOG4145 nph NP3886 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


13070|hp|hbo      MCMNGSGPASISDIQCRHVDTYESNPDRIEADA----------------GTERQDRADYE
3886|hp|nph       -----MSVLSEQELRSRWRERWGNFLSHVQEASTPEAARNALRDKVIIGNAERKIAGGHE
                        .  * .::..*. : : .  ..::  :                .:**:  ..:*

13070|hp|hbo      GRFVFELLQNAVDEM--DDTGEPRVRFELTEDSLLVANNGAAFSFEDLYALTLTTRTTKA
3886|hp|nph       GREILELLQNARDAIRQGDAEQGRVYVGVYDEGVLVANTGSRF---DLFDEQVEDAVTMI
                  ** ::****** * :  .*: : ** . : ::.:****.*: *   **:   :   .*  

13070|hp|hbo      GET-------TIGHKGRGFTSVLGVTDNPSVYS---------------------------
3886|hp|nph       GETGKGDDDQSIGHKGVGLKSILATGDSFEIFTRPDESADDILAVRLSRAYLVAAILNRL
                  ***       :***** *:.*:*.. *. .:::                           

13070|hp|hbo      ------ENVQAQFNRKTTADLLKG---NDKISAERDDALAAEQVPLLCLP-------HET
3886|hp|nph       GQDGNVSTLTDDLDDAALHDLLEDGTPNETVSLPEDLRDSISKLPLFNFPVPLAMDESEV
                        ..:  :::  :  ***:.   *:.:*   *   : .::**: :*        *.

13070|hp|hbo      TTPP---RVRALLNDGFTTVFKLPLRDPARHRESIHTKLEGLDANTVALLPQLQEIEISS
3886|hp|nph       ATDPIRSRARDLLTDSPAT------GGENQFRTAVFIRYEDDDWRS-----QLADIGISV
                  :* *   *.* **.*. :*       .  ..* ::. . *. * .:     ** :* ** 

13070|hp|hbo      LGQD------------WEWEIARHDMTGCDA-TLIEL-------TTDTADGPEET--RTD
3886|hp|nph       PEEENTGSIEDRPQRIWDYLSATASEDGLQPETLVQLGGIEEFILERATDGGRKTVNKER
                    ::            *::  *  .  * :. **::*          ::**  :*  .  

13070|hp|hbo      WFCLFE------QTDLDQKQISDRADLTQPEVDAMGELSVGIAFSVTPGDSPPSLRPKGW
3886|hp|nph       WEIVRDPSPHVVTSDLSHQEV--RVRIHADDDESLHR------FDQFQFETPRQHHTAVL
                  *  : :       :**.::::  *. :   : :::        *.    ::* . ..   

13070|hp|hbo      KLKPVYGETHNQPPY-LHVFLPTKERSP--IPALVTGTFQSDTSRRNLTLNYDDSRGYDG
3886|hp|nph       VNKAADGERVPTASYPLYLFYPIEGTSTAGLPFCFHGRFRVETNRKDLSSNNLATNRSVL
                    *.. **    ..* *::* * :  *.  :*  . * *. :*.*.:*: *   :.    

13070|hp|hbo      QFNALLFMAVGELLADSVISFVEQSATSEGDFLTTLDPSLGQGRDWSFTKGTVEGCLFDA
3886|hp|nph       EEGLDLIELIGQEVA--IAATDTDSPTYSTHLPWCLLPPVPDAD--GLSEPTSNDELLNW
                  : .  *:  :*: :*  : :   :*.* .  :   * *.: :.   .::: * :. *:: 

13070|hp|hbo      IK----TRLTSVEFLPSARANQRVAIDDITVPPTSAQLSDLGTDFVSLL----QSGDSQA
3886|hp|nph       FRLEVFERLGATDCLPSVDGPRQ---PEATLLHWDETVLEGQLAYRTLVDHLGRTTETAT
                  :.     ** :.: ***. . ..    : *:   .  : :    : :*:    .: :: :

13070|hp|hbo      DDRPHVPSAELST--------HQHAQTLVAYGASQYDASSVPEALAAVSVDPPLRIVDER
3886|hp|nph       DSTPLLTQEALDALLGVPAAWRERLQKLLAVEDEQAASRALLEEWVAQ-LDATLAM----
                  *. * :..  *.:        .:. *.*:*   .*  : :: *  .*  :*..* :    

13070|hp|hbo      EFGRTPPDDDEPCRLTVDPVLVYLVR-----LRKTLESDED-RSAFDDACRRHD---VFP
3886|hp|nph       ------DDDDSPAHIVPATAARTLLQGTVTLLTAATEGDESLDEALTDLADRFDGIYLLP
                         ***.*..:.  ..   *:.     *  : *.**.  .*: * . *.*   ::*

13070|hp|hbo      VEIKTDQEGTKHAIRGSNEAGTIFMPPEGDITADALPT----LEFLPRDLYHGTNADRAA
3886|hp|nph       CRIRDVDPEEELALVTIERRQT---PTGGQRTQRRIRSVIWDIESATRDIERPPTPPQSS
                    *.  :   : *:   :   *   *. *: *   : :    :*  .**: . ... .::

13070|hp|hbo      ---------PLREDALPANFDADVQTIWDINDYLFSQVFDTAISPHLPGPNSPNADPSIL
3886|hp|nph       NMTVYFLDEAVQEDAAVHHVLNTAGRVWGLRAYEGIPSFVRSLLDTFADGRHDVVEPIDF
                           .:.***   :.   .  :*.:. *     *  ::   :.. .   .:*  :

13070|hp|hbo      ASGGVL--RTIREMTDVQSPENDRSP----ESPLLYQSAKKPYSALAQLPVPTQPTEDGT
3886|hp|nph       AFLTALVDRIGDESDDLQTGEGEFFPLGYLKTAVTQQEGDQRANLRRRVQLRTCDLQLHR
                  *   .*  *   *  *:*: *.:  *    ::.:  *...:  .   .: : *   :   

13070|hp|hbo      VEWHPAHRVYFSSDWQTTLNRPEDAYIEPFLNAVAAQTDSERFDPKFLASPSWFTTDKDE
3886|hp|nph       TEAQPISDTVLPDEWQSVRERALASEDERQEQDSEITEDWTGVTPGEYPAPAWPTPDTD-
                  .* :*   . :..:**:. :*.  :  *   :      *   . *   .:*:* *.*.* 

13070|hp|hbo      ERVETLKAWAAFFSWLGV----FEHLRPLPLFAPGEQQTYRQTQGLSQPSNSTITASEDL
3886|hp|nph       -------TWSVYREQIKRDVTDVDFVRALSLLGAG---SLPGVNVLWMYGDDHPSMRRDH
                         :*:.: ..:      .:.:*.*.*:..*   :   .: *   .:.  :   * 

13070|hp|hbo      QRDGVYSVDHRYTGLTDVEWQSYRDHLVDAVTSEIPDPDEQYLFQVNSLEYASEILSAAK
3886|hp|nph       HWDPMEWTEDDFTGTTP---DTVRE--LQSTLSDVPD----YRSLITGLEYHPRFSADHS
                  :.* :  .:  :** *    :: *:  :::. *::**    *   :..*** . : :  .

13070|hp|hbo      QSGEV---GSRLLRHLTRW-W----------DHGLSK--RRHAT--VAEFTNERWRGSNV
3886|hp|nph       SKCNVKTDGDLNQVNLASWVWIDDTERLVEHDHAVREVLRRHGESLVSTLLQTGWSCNNG
                  .. :*   *.    :*: * *          **.: :  ***.   *: : :  *  .* 

13070|hp|hbo      SYVFTHDEQSALGWNLWVWQLRQ-SSWVPTSFDAVRPTAAWSLPRSDRERFSLDVNGLQP
3886|hp|nph       HKRRSWTEPVP---SLLNWQLRDLEIWEPVVEVDEELEEQWT-DYAAQLRFAVRKESSRG
                      :. *  .   .*  ****: . * *.          *:   : . **::  :. . 

13070|hp|hbo      LLPFVDGDFPTRESETPVSFEELADTLGIGVRLEQGTFSPQDAERVISRVGELLA-----
3886|hp|nph       --AQAARMFPHVDDETGFS-EEVLATLGVR---PIGDLGPTGATKRLQQLQAVLTDGPLP
                    . .   **  :.** .* **:  ***:      * :.* .* . :..:  :*:     

13070|hp|hbo      -------WTDDD-LAQYSSAVELLYTRVAELLPRLTHGNQISGEWD-----PEQSG---L
3886|hp|nph       EDGPASLWIPGERINDWNQAYTQLLQPLVRQFPDDPAKQRDELNWGSLTHLPLRDGDQWL
                         *  .: : ::..*   *   :.  :*  .  :. . :*.     * ..*   *

13070|hp|hbo      ADALVLCRVDDK------------YSLKRAGDT-YFVRSRSSRDRYGNLGVPL-LAMFKS
3886|hp|nph       TAPVEWIQANSDQIRYYQDQSPKPWELQTAEENDYYILPRPRSGPFVQLATALGVDQLQA
                  : .:   ..:..            :.*: * :. *:: .*.  . : :*...* :  :::

13070|hp|hbo      EAVSLGEYCGATDL-------------RAAVEKQPGY------GDERPLPTSVSGFEIDT
3886|hp|nph       SKLVLDLENDDLDVVTDQYSDRIAEFQRALTERQDLFVASTERSDEEEIVDTAENLSTAA
                  . : *.   .  *:             ** .*.*  :      .**  :  :...:.  :

13070|hp|hbo      TWLQTV--LAALVLRLRTNRPSSALVDQDTTRTKSFFE-----NIVFVTDLDLNITL---
3886|hp|nph       ANIAVVESFPDDVLRQLSD-PASALYETDDGEEALLLNAAEAGDSLSLQGLSMGIALLVE
                  :.: .*  :.  ***  :: *:*** : *      :::     : : : .*.:.*:*   

13070|hp|hbo      --------------------TDGSWNRNLDP---------KPQPYHIERDGDTITTIL--
3886|hp|nph       RPTKVATFREALRSDVEVDELESRWKKRTFPIDTVKRVLGSNALQSIERDVTAVNDLLDR
                                       :. *:..  *         .     ****  ::. :*  

13070|hp|hbo      IDAT-LNREAFVDALTGAFTDRLDVPQYYEA------VNNLIDHAFGNETPAI-------
3886|hp|nph       LDRSPIDADPLLDALEDADPETIDLVREWCATGERPDVGTDADLDLTDLDPAIEEWITEF
                  :* : :: :.::*** .* .: :*: . : *      *..  *  : :  ***       

13070|hp|hbo      --ALRERLRTVGSEVPNGQIEVTRKALFESDHED-------------------PPKDDG-
3886|hp|nph       HAALPDELEFVAAGIFSETVTHWIRELEGQDVDEMTAVIVIDWLDEQRAALERPPFDNAA
                    ** : *  *.: : .  :    . *  .* ::                   ** *:. 

13070|hp|hbo      ---------VTDHPPDPKPDNGGAFDS-TTNTQTAAANGGSGSSTGTAGTSAHSSRIPSI
3886|hp|nph       RQAYVRLETVAELWEQTDPAELTELDTWSDRLRELHSSAVPDWSDPIPESYAEALDCPAL
                           *::   :..* :   :*: : . .   :.. .. *   . : * :   *::

13070|hp|hbo      DAVTRIGDR-------------------------RIAESLRNADVSTNPPDNGGRQ----
3886|hp|nph       VAHVSINDRVHVLVETICEEIDAELPDVEFDWHGLVTTYVEEGTIPEPETDRGAKDHQER
                   * . *.**                          ::  : :. :.   .*.*..:    

13070|hp|hbo      -----------------------------DLGNEQSTSSSHIGGG-GAASQEYR---DEI
3886|hp|nph       AFADLATAIDTNGELAGGSSDGPLMPETVDISDGSGSLSVSEGGGSGGGSTQYRGRGQQA
                                               *:.: ..: *   *** *..* :**   :: 

13070|hp|hbo      DAFGMAITLDAERTRLAD---ADEPNPESKVFDVHTPEEYLKHREH------SELL----
3886|hp|nph       EAYVMAGVLDRIATWLDEHPAGDIRQFRSRFKRLHSDQQEQSYKWHVENVWSSDLLPLLR
                  :*: ** .**   *.* :   .*  :  *..  :*: ::  .:. *      *:**    

13070|hp|hbo      ---------------ESAIHRFADQRGLSAAENPLDRDWPGFDVLT----IRTDDNGDAV
3886|hp|nph       DSDALNSVTVSDWRTEVDAESFAEFPLVRLVNVTMERG-PGFDVIDPLGPLSDDEETDDF
                                 *     **:   :  .: .::*. *****:     :  *:: * .

13070|hp|hbo      IDRCIELKTSGLNTRKPSLSW----NEWKAAGGPLSKHYYLYVARNIRLGNSGDAELLEI
3886|hp|nph       GLQFVPVEVKAVNGTTPPFNFRLTTNEYRQAKAFVRDGNIPYVIRLVSVPEAGTPDW---
                    . : ::...:*  .*.:.:    **:. * . : .    ** * : : ::* .:    

13070|hp|hbo      PQPFDRLRNRQRETRERNVQVDLRSFDFDDDPIIE---RPIEWEE
3886|hp|nph       PSQTE-IAAEQILSTEAELEAVVESQRFEE--VVKGGYMNMKIEE
                  *.  : :   *  : * :::. : *  *::  :::     :: **