HOG Organism Gene ID Name Annotation
aHOG4131 hbo HBOR37920 Hbor_37920 hypothetical protein
aHOG4131 hbo HBOR37930 Hbor_37930 site-specific recombinase XerD
aHOG4131 nph NP3892 hypothetical protein
aHOG4131 nph NP3894 integrase-like protein
MUSCLE (3.6) multiple sequence alignment


37920|hp|hbo        MSTGAFTVP-METSRRYIPEEMKEFDHWVLWSPEFGKQIMAPWVTGHCYPASWGEQETER
3894|gene|nph       -----------MTGRGFKPLKLDQIQVF--------------------------------
37930|gene|hbo      MGTGHFNKDRITHLERYRPLEPDQIPTW--------------------------------
3892|hp|nph         -----MNGD---------PLTREQTAAF--------------------------------
                                      *   .:   :                                

37920|hp|hbo        PETTFEKAKMLADLPTEEVHRTYPFPPKDGEEEPHVPERIIPTFLLLHDPPEPPLMQVDF
3894|gene|nph       ---------------------------EEAAKDADNPIRTLTGRLLLHT----GMRNGEF
37930|gene|hbo      ---------------------------KEAAKDGK-PIEELLGLTLLHT----GIRRTTM
3892|hp|nph         ---------------------------RQAADQGD-FVDRLL-MVLLHT----GLTATEF
                                                :. .:       :    ***      :    :

37920|hp|hbo        DDVRDPASGCVSEEVEEIVERLDAFTEVSQ-SGEGLHVFVRAELPGGLG-KFIAELDDVG
3894|gene|nph       NHMR-P-----------WWVLEKN-------GNYRIDIPRREECVGGAG-E--AGFGNQN
37930|gene|hbo      AHMTEA-----------WLNLDDE-------ENPHVKIPPRQECTLGRG-K--QGSG---
3892|hp|nph         THMHDN-----------WLEPLPESVEAYQGDTPIIRIPTEADC---RGIK--LGTN---
                      :                                : :    :     * :     .   

37920|hp|hbo        EIEMYDHGRVVG----------ATWRHVEGTPTD----VPERQDVVEDLIKTYESEEYRQ
3894|gene|nph       QFDLSDRGKPCSKCRNRPHREDNRW-TCKTRSSDRTIPINSEQEDLIDLLKWWKE-----
37930|gene|hbo      -GDTKNTGQPCYNCREKRP---GYW---KPKSHHGVRPIPIREEDVEEILRNYFS-----
3892|hp|nph         -LEIHQRTGRCGYCNDLGY---EVWHPGQPDSDCRVRSIPIPDETTARTLYWWFA-----
                      :  :                  *   :  .      :   ::     :  :       

37920|hp|hbo        RRLRSSSEDASETDWNSDVSGIEAAIRNRENDSSSSGRSPYFDIDIRSIADTGDFSRYRR
3894|gene|nph       -----------------------------GYDYLPLSHRS-VNYHLKQLAEEAGLN--RK
37930|gene|hbo      -----------------------------VHDTVG-GREK-VNYYVEKISDRADLG--RE
3892|hp|nph         -----------------------------RYDSTPISVNS-LERRLSKLADRADIG--RD
                                                   *    .    .:  : .::: ..:.  * 

37920|hp|hbo        ETPGDEWQGPHPAHGPMHSDPEECTNFGVEPSGNTWFCFAHNAGGRAIELAAVLADEVDV
3894|gene|nph       VTAHD----LRHTHGTMLA----------------------RMDWTAVQIMDRLG-----
37930|gene|hbo      VTPHD----LRNTYGTRLA----------------------RKGFTPHEIMHLMG-----
3892|hp|nph         VTSRD----VRATYGTNLV----------------------RMGFSSEEIAKLMGLFHHI
                     *. *     . ::*.                         . .  . ::   :.     

37920|hp|hbo        SCADIPKRGAGQGWLGDRPVKMLKTCLWLRD----HAGVPDDTKPPHAALLGVAD--VED
3894|gene|nph       -----------------------------------HGSIQ-----------------MPR
37930|gene|hbo      -----------------------------------HSSIG-----------------IAR
3892|hp|nph         STREFFEAADEPVDWPEVVSDATILAAIAENEPVIKSDVGDLVGFSVTAGRKRANDLIDR
                                                       :..:                  :  

37920|hp|hbo        LYVRDRDRGILGEKNAELC-------------RRVFDEMTLDYFE-----
3894|gene|nph       KYIT-----YTAQASRDLV-------------EEKYDMDNL---------
37930|gene|hbo      FYIK-----MSGTR-----LGLAY--------DEKW--------------
3892|hp|nph         GILK-----KVGERHEGHVHGTTYGIDPSVLKDEGYHEIAERYYKARLEQ
                      :        .                       :