HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0413COG0250arCOG01920Transcription antiterminatortranscription termination-antitermination factor

HOG Organism Gene ID Name Annotation
cHOG0413 nrc1 VNG0374 nusG transcription termination-antitermination factor
cHOG0413 hmu HMUK2938 Hmuk_2938 NusG antitermination factor
cHOG0413 hma RRNAC0698 nusG transcription antitermination protein NusG
cHOG0413 hwa HQ1241A nusG transcription antitermination protein NusG
cHOG0413 hla HLAC0899 Hlac_899 NusG antitermination factor
cHOG0413 hbo HBOR24980 Hbor_24980 LSU ribosomal protein L24A
cHOG0413 hut HUTA0893 Huta_0893 NusG antitermination factor
cHOG0413 hvo HVO_0719 HVO_0719 rplX ribosomal protein L24
cHOG0413 nph NP0814A nusG transcription antitermination protein NusG
cHOG0413 hhi 1348 nusG transcription antitermination protein NusG
MUSCLE (3.6) multiple sequence alignment


899|gene|hla        ---MPIFSVKTTARQERTVADMLAEKEMPEIQAVIAPDQLTSYVMVEATDGSVFARILDE
1241|gene|hwa       ---MSIFAVKTTASQERTVADMIATREEPDIHAVLAPDSLTSYVMVESDSNAAISRVLEE
24980|gene|hbo      MSEVPIFAVKTTARQEQTVADMIATREEAEIHAVLAPDSLTSYVMVEADNNAVINRVLEE
814|gene|nph        ---MAIYSVKTTASQERTVADMLISREEEGIHATLAPDALTSYVMVEADDTAAISRALED
374|gene|nrc1       ---MSVFAVKTTASQEQTVASMIANREEDTIHAVLAPDALTSYVMVEAEDTAAIERTMDE
10698|gene|hma      ---MGIYAVKTTASQERTVADMIISREEDEIHAALAPDSLTSYVMVEADDHNVFDRILDE
1348|gene|hhi       ---MGIYAVKTTASQERTVADMIISREEDEIHAALAPDSLTSYVMVEADDHNVFDRILDE
893|gene|hut        ---MGIFAVKTTASQERTVADMIMNREEDSVHAALAPDSLTSYVMVEAEDASVFERILDE
                       : :::***** **.***.*:  .*   ::*.:*** ********: .  .: * :::

899|gene|hla        IPHARGVIQGSEGPAESPFSEVEHFLSPTPDVEGIAEGDIVELIAGPFKGEKARVQRIDE
1241|gene|hwa       IPHARGLVKSGGQAGKSTIAEVEHFLSPTPDVEGIAEGDIVELIAGPFKGEKARVQRIDE
24980|gene|hbo      IPHARGLV--GDGQATSSMAEVEHFLSPTPDVEGIAEGDIVELVAGPFKGEKARVQRIDE
814|gene|nph        IPHARTLV----SEQPSPFSEVEHFLSPKPDVEGIAEGDIVELIAGPFKGEKAQVQRIDE
374|gene|nrc1       IPHARSLV-----PGESGISEVEHFLSPKPDVEGIAENDIVELIAGPFKGEKAQVQRIDE
10698|gene|hma      IPHANGVV-----QGESSMAEVEHFLSPKPDVEGIAEGDIVELIAGPFKGEKAQVQRIDE
1348|gene|hhi       IPHANGVV-----QGESSMAEVEHFLSPKPDVEGIAEGDIVELIAGPFKGEKAQVQRIDE
893|gene|hut        IPHANGVV-----QGKSSIKEVEHFLSPTPDVEGIAEGDIVELIAGPFKGEKAQVQRIDE
                    ****. ::        * : ********.********.*****:*********.******

899|gene|hla        GKDQVTVELYEATVPIPVTVRGDQIRVLDSDER
1241|gene|hwa       TKDQVTVELYEATVPIPVTVRGDQIRVLDSDER
24980|gene|hbo      TKDQVTVELYEATVPIPVTVRGDQIRVLDSDER
814|gene|nph        GKDQVTVELYEATVPIPVTVRGDQIRVLDSEER
374|gene|nrc1       GKDQVTVELYEATVPIPVTVRGDQIRVLDSEER
10698|gene|hma      GKDQVTVELYEATVPIPVTVRGDQIRVLDSEER
1348|gene|hhi       GKDQVTVELYEATVPIPVTVRGDQIRVLDSEER
893|gene|hut        GKDQVTVELYEATVPIPVTVRGDQIRVLDSEER
                     *****************************:**