HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0412COG0085KOG0216 KOG0214 KOG0215arCOG01762DNA-directed RNA polymerase beta subunit/140 kD subunitDNA-directed RNA polymerase subunit B''

HOG Organism Gene ID Name Annotation
cHOG0412 nrc1 VNG2666 rpoB'' DNA-directed RNA polymerase subunit B''
cHOG0412 hmu HMUK0515 Hmuk_0515 RNA polymerase beta subunit( EC:2.7.7.6 )
cHOG0412 hma RRNAC2430 rpoB DNA-directed RNA polymerase subunit beta''
cHOG0412 hwa HQ3396A rpoB2 DNA-directed RNA polymerase subunit beta''
cHOG0412 hla HLAC0107 Hlac_107 RNA polymerase beta subunit
cHOG0412 hbo HBOR28240 Hbor_28240 DNA-directed RNA polymerase, subunit B''( EC:2.7.7.6 )
cHOG0412 hut HUTA0784 Huta_0784 RNA polymerase beta subunit
cHOG0412 hvo HVO_0347 HVO_0347 DNA-directed RNA polymerase beta subunit
cHOG0412 nph NP0110A rpoB2 DNA-directed RNA polymerase subunit beta''
cHOG0412 hhi 2862 rpoB'' DNA-directed RNA polymerase subunit B''
MUSCLE (3.6) multiple sequence alignment


2666|gene|nrc1      MLQEDKRELSESYFSKERLAEHHFRSYNAFLEHGMQDVVTEKERIETDIGDKEDEEPVWV
110|gene|nph        MNREDRRSVSREYFSRERLAEHHFRSFNNFLDRGMQDVVDEKESIDTDIGDKEGQEPVRV
3396|gene|hwa       MNREDRRTVSREYFSEDRLAEHHFRSFNNFLERGMQDVVTEKERIETDIGDKEGEEPVFV
28240|gene|hbo      MNRQDRRAVSRQYFSQERLAEHHFRSFNNFLERGMQEVVSEKATIDTDIGDKEGEEPVYV
107|gene|hla        MNRQDRRVVSREYFSDERLAEHHFRSFNNFLDRGMQEVVDEKETIETDIGDKEGQEPVYV
12430|gene|hma      MDTQDRRAISREYFAKERLAEHHFRSFNAFLDRGMQQVVDEKETIETDIGDKEGQEPVWV
2862|gene|hhi       MDTQDRRAISREYFAKERLAEHHFRSFNAFLDRGMQQVVDEKETIETDIGDKEGQEPVWV
784|gene|hut        MDTENRRTISREYFSRDRLAEHHFRSFNAFLDRGMQEVVDEKATIETDIGDKEGEEPVWV
                    *  ::.* :* .**: :*********:* **:.***:** **  *:*******.:*** *

2666|gene|nrc1      ELGDVRAVTPRVREADGSEELLYPQEARLRNITYSAPVFMEMSIVRGGEEEEERVLDTTE
110|gene|nph        DLGNVRIVTPRVREADGSEELLYPQEARLRNITYSAPVFMEMSIVRGGDEEEEQVVDQAE
3396|gene|hwa       ELGDVRIETPRVREADGSEELLFPQEARLRNITYAAPVFMEMSIVRGGDEEQEVVVDNTE
28240|gene|hbo      ELGDIRIETPRVREADGSEELLFPQEARLRNITYAAPVFMEMSIIRGGEEEEEVVVDTTE
107|gene|hla        ELGDVRMVTPRVREADGSEELLYPQEARLRNITYSAPVFMEMSIVRGGEDEPEQVVDTTE
12430|gene|hma      ELGDVRVVTPRVREADGSEELLYPQEARLRNITYSAPVFMEMAIVRGGEEEPEEVVDRTE
2862|gene|hhi       ELGDVRVVTPRVREADGSEELLYPQEARLRNITYSAPVFMEMAIVRGGEEEPEEVVDRTE
784|gene|hut        ELGDVRIVTPRVREADGSEELLYPQEARLRNITYAAPVFMEMAIVKGGEEEEERVVDQTE
                    :**::*  **************:***********:*******:*:.**::* * *:* :*

2666|gene|nrc1      TKVGRMPIMVGSDKCNISGFSDEELIEIGEDPADPGGYFIINGSERVLMTSEDLAPNKIL
110|gene|nph        TKVGRMPVMVGSNKCNIADFNDEELIEIGEDPADPGGYFIVNGSERVLMTSEDLAPNKIL
3396|gene|hwa       TKVGRMPIMVGSTKCNIAGLTDEELIDIGEDPVDPGGYFIVNGSERVLMTSEDLAPNKIL
28240|gene|hbo      TKVGRMPIMVGSSKCNISNLTDEELVEIGEDPVDPGGYFIVNGSERVLMTSEDLAPNKIL
107|gene|hla        TKVGRMPIMVGSNKCNMAGFSDDELIDIGEDPVDPGGYFIVNGSERVLMTSEDLAPNKIL
12430|gene|hma      TKIGRMPIMVGSNKCNIAGFTDEELIDIGEDPADPGGYFCVNGSERVLMTSEDLAPNKIL
2862|gene|hhi       TKIGRMPIMVGSNKCNIAGFTDEELIDIGEDPADPGGYFCVNGSERVLMTSEDLAPNKIL
784|gene|hut        TKVGRMPIMVGSQKCNIAGFSDEELIDIGEDPADPGGYFIVNGSERVLMTSEDLAPNKIL
                    **:****:**** ***::.:.*:**::*****.****** :*******************

2666|gene|nrc1      AEYDSKYGDEIQVAKTFSQRRGYRALVLVERNREGLLEVSFPSVSGSISFVTLVRALGLE
110|gene|nph        AEYDTKYGDEIQIAKTFSQRRGYRALVLCERNRNGILEVSFPSVSGSINFVTLVRALGLE
3396|gene|hwa       AEYDSKYGDEIQVAKTFSQRRGYRALVLCERNREGLLEVSFPSVSGSVEFVTLVRALGLE
28240|gene|hbo      AEYDTKYGDEIQVAKTFSQRRGYRALVLCERNREGILEVSFPSVSGSVEFVTLVRALGLE
107|gene|hla        AEYDSKYGDEIQVAKTFSQRRGYRALVLCERNREGLLEVSFPSVSGSIDFVTLVRALGLE
12430|gene|hma      AEYDTKYGDEVQVAKTFSQRRGYRALVLCERTRDGLLEVSFPSVSGSIDFVTLVRALGLE
2862|gene|hhi       AEYDTKYGDEVQVAKTFSQRRGYRALVLCERTRDGLLEVSFPSVSGSIDFVTLVRALGLE
784|gene|hut        AEYDTKYGDEVQVAKTFSQRRGYRALVLTERTRDGLLEVSFPSVSGSVNFVTLVRALGLE
                    ****:*****:*:*************** **.*:*:***********:.***********

2666|gene|nrc1      SDEEIVHRVSEDPEIVKFMLENLEEADVQTQEEAIEDLGQRVASGQGKNYQLKRANYVID
110|gene|nph        SDEEIVHRVSDDPEIVKYMLENLEAAEVQTTSEAIETLGQRVAAGQGKNYQLKRANYVID
3396|gene|hwa       SDEEIVHRVSDDPEIVKFMLENLEEASVQTEEEAIETLGKRVASGQGKNYQLKRANYVID
28240|gene|hbo      SDEEIVHRVSDDPEIVKYMLENLEEAEVQTEAEAIESLGKRVASGQGKNYQLKRANYVID
107|gene|hla        SDEEIVHRVSDDPEIVKFMLENLEEAEVQTTEGAIETLGERVASGQGKNYQLKRANYVID
12430|gene|hma      SDEEIVHRVSEDPEIVKFMLENLEEAEVQTTEEAIETLGKRVASGQGKNYQLKRANYVID
2862|gene|hhi       SDEEIVHRVSEDPEIVKFMLENLEEAEVQTTEEAIETLGKRVASGQGKNYQLKRANYVID
784|gene|hut        SDEEIVHQVSDDPEIVKFMLENLEAAEVQTQEEAIETLGQRVASGQGKNYQLKRANYVID
                    *******.**:******:****** *.***   *** **:***:****************

2666|gene|nrc1      RYLLPHLHEDGVEEEETRINKAYYLCRMAEACFELALGRREADDKDHYANKRLKVSGDLM
110|gene|nph        RYLLPHLHEEGVEDEEVRMNKAVYLCRMAEACFELALGRRESDDKDHYANKRLKVSGDLM
3396|gene|hwa       RYLLPHLHEDGIEEEAVRINKAYYLCRMAEACFELALDRRESDDKDHYANKRLKVSGDLM
28240|gene|hbo      RYLLPHLHEDGVDEEDVRINKAFYLCRMAEACFELALERRDSDDKDHYANKRLKVSGDLM
107|gene|hla        RYLLPHLHEEGVDEEDVRINKAYYLCRMAEACFELALERREADDKDHYANKRLKVSGDLM
12430|gene|hma      RYLLPHLHEEGVEEEEVRINKAFYLCRMAEACFELALGRRESDDKDHYANKRLKVSGDLM
2862|gene|hhi       RYLLPHLHEEGVEEEEVRINKAFYLCRMAEACFELALGRRESDDKDHYANKRLKVSGDLM
784|gene|hut        RYLLPHLHEEGIDEEETRINKAYYLCRMAEACFELALDRRESDDKDHYANKRLKVSGDLM
                    *********:*:::* .*:*** ************** **::******************

2666|gene|nrc1      KDLFRTALNKLARDVKYQLERANMRNRELTVNTVVRSDVLTERLEHPIATGNWVGGRSGV
110|gene|nph        KDLFRTALNKLSRDVKYQLERANMRNRDLSVSTVVRSDVLTERLEHPIATGNWVGGRSGV
3396|gene|hwa       KDLFRTALNKLARDVKYQLERANMRNRQLTVSTVVRSDVLTERLEHPIATGNWVGGRSGV
28240|gene|hbo      KDLFRTALNKLARDVKYQLERANMRNRQLTVNTVVRSDVLTERLEHPIATGNWVGGRSGV
107|gene|hla        RDLFRTALNKLARDVKYQLERANMRNRDLTVNTVVRSDVLTERLEHPIATGNWVGGRSGV
12430|gene|hma      TDLFRTALNKLARDVKYQLERANMRNRQLSVSTVVRSDVLTERLEHPIATGNWVGGRSGV
2862|gene|hhi       TDLFRTALNKLARDVKYQLERANMRNRQLSVSTVVRSDVLTERLEHPIATGNWVGGRSGV
784|gene|hut        RDLFRTALNKLARDVKYQLERANMRNRQLSVSTVVRSDVLTERLEHPIATGNWVGGRSGV
                     **********:***************:*:*.****************************

2666|gene|nrc1      SQLVDRTDFMGVLSHLRRLRSPLSRSQPHFEARDLHATQWGRICPSETPEGPNCGLVKNF
110|gene|nph        SQLVDRTDYMGVLSHLRRLRSPLSRSQPHFEARDLHATQWGRICPSETPEGPNCGLVKNF
3396|gene|hwa       SQLVDRTDYMGVLSHLRRLRSPLSRSQPHFEARDLHATQWGRICPSETPEGPNCGLVKNF
28240|gene|hbo      SQLVDRTDYMGVLSHLRRLRSPLSRSQPHFEARDLHATQWGRICPSETPEGPNCGLVKNF
107|gene|hla        SQLVDRTDYMGVLSHLRRLRSPLSRSQPHFKARDLHATQWGRICPSETPEGPNCGLVKNF
12430|gene|hma      SQLVDRTDFMGVLSHLRRLRSPLSRSQPHFEARDLHATQWGRICPSETPEGPNCGLVKNF
2862|gene|hhi       SQLVDRTDFMGVLSHLRRLRSPLSRSQPHFEARDLHATQWGRICPSETPEGPNCGLVKNF
784|gene|hut        SQLVDRTDFMGVLSHLRRLRSPLSRSQPHFEARDLHATQWGRICPSETPEGPNCGLVKNF
                    ********:*********************:*****************************

2666|gene|nrc1      AQAMELSQDVDDERDLKQELSSMGVEGIPGISMETTSTT----SADD
110|gene|nph        AQAMELSQSVEDERRLKRELASMGVEGIPGI--ETVETH----TADD
3396|gene|hwa       AQAMELSQNVEDEQSLKRELSSMGVDIFHTS--TSTDDTDTRSPADD
28240|gene|hbo      AQAMELSQNIEDEQALKRELASMGVEGIPGI--EGPDPTNT--PADD
107|gene|hla        AQAMELSQTVDDEQGLKRELASMGVEGIPGI--EGVDRQ----TADD
12430|gene|hma      AQAMELSQDVSDPQGLKQELAEMGVQGIPGI--ESIEQQ----PADD
2862|gene|hhi       AQAMELSQDVSDPQGLKQELAEMGVQGIPGI--ESIEQQ----PADD
784|gene|hut        AQAMELSQHVEDERELKQTLAEMGVQGIPAI--ETAAQQ----PADD
                    ******** :.* . **. *:.***: :               .***