HOG Organism Gene ID Name Annotation
aHOG4119 nph NP3638 htr8 transducer protein htr8
>3638|gene|nph !!AA_SEQUENCE 1.0
MTDTESALERFRSGIPDGTRIDDGQFRLRHRFIVGSLVLQAPLLFVLSRASGTGGITGVP
YPEIPLAHGLAGSGIILVLAGLSLLPMLSQRMQSITASFGFMTCAAVLAYFWGGFVEAHF
LYFVGIGVVAMYEDWLPLGLGVAYVAVQHSLFGHTYGEMVYNHEPAMSNPMVWGLIHAGF
VLLLVGAVLFQWRSIETTRDSLDDRVDDVETLEQQRAEIETARSEAEAQRGQLNELNETL
QAEAGAVAAALTAVANRDLTATPPEDSDIEAVQDISGAYREMTGDLSSVLSDLRSFADTV
DQTTGAIRERAADLESKQREQADDVRELAAELETQTEQLESARTEMDDLSAVIEEIAAST
QEVSGETGDVAELAAEGSNEAAAAAEAVNEVTEQVATVAELTETLNQRMSDVEETTALID
DIAEQTNILALNANIEAARADGASNDGFGVVADEVKELAAETQKHSTTIQGTVAETLGDV
ADVHEDVERLDTVAASGADSVEAVAALFEQVDSAAEGLQTSADEVARATDDGAASTEEVT
SVIDGVADKARELADIGTAAADASESTADAVAEIRAELADLGEETATLQAELDRFTLQNN
GEAGPTGDTDSGPTAADD