HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0411COG0047arCOG00102Phosphoribosylformylglycinamidine (FGAM) synthase glutamine amidotransferase domainphosphoribosylformylglycinamide synthase I

HOG Organism Gene ID Name Annotation
cHOG0411 nrc1 VNG1945 purL2 phosphoribosylformylglycinamide synthase I
cHOG0411 hmu HMUK1426 Hmuk_1426 phosphoribosylformylglycinamidine synthase I( EC:6.3.5.3 )
cHOG0411 hma RRNAC3268 purQ phosphoribosylformylglycinamidine synthase I
cHOG0411 hwa HQ3131A purQ phosphoribosylformylglycinamidine synthase component I
cHOG0411 hla HLAC1249 Hlac_1249 phosphoribosylformylglycinamidine synthase I
cHOG0411 hbo HBOR06280 Hbor_06280 phosphoribosylformylglycinamidine synthase subunit I( EC:6.3.5.3 )
cHOG0411 hut HUTA2232 Huta_2232 phosphoribosylformylglycinamidine synthase I
cHOG0411 hvo HVO_2188 HVO_2188 purQ phosphoribosylformylglycinamidine synthase I
cHOG0411 nph NP5010A purQ phosphoribosylformylglycinamidine synthase, component I
cHOG0411 hhi 513 purQ phosphoribosylformylglycinamidine synthase I
MUSCLE (3.6) multiple sequence alignment


3131|gene|hwa       MTVVVVQFGGSNCDRDAVRALQHIGIDATRVWHEDGLNDSVENLDGIILPGGFSYGDYLR
2232|gene|hut       MTVAVIQFGGSNCDRDTVQALESIGVDAELVWHEDDLP---ADAEGIVLPGGFSYGDFLR
13268|gene|hma      ------------------------------------------------------------
513|gene|hhi        MTIAVIQFGGSNCDRDSVQALESLGFDAELVWHEDGLP---EDVDGVVLPGGFSYGDYLR
5010|gene|nph       MTVAIIRFGGSNCDRDAERALAHLDIDAEIVWHEDGLP---EETTGVMIPGGFSYGDYLR
6280|gene|hbo       MTVSVIQFGGSNCDRDAVRALEHLGIDAERVWHEDELP---EDVTGIMLPGGFSYGDYLR
1945|gene|nrc1      MTVAVVRFGGSNCDRDAVRALAHLGVDAAVAWHDDGLP---ADTDGVVVPGGFSYGDYLR
1249|gene|hla       MTVSVVQFGGSNCDRDAVRALEHVGVDAGRVWHEDGLP---ADTEGIVLPGGFSYGDYLR
                                                                                

3131|gene|hwa       AGAMAAHSPIVNDIQAAAERGIPVLGVCNGAQVGCESGLTPGAFTTNDRARFQCETVHLR
2232|gene|hut       AGAMAAHSPIMAEVRAAADDGTPVLGICNGAQIGCEASLTPGAFTTNESARFQCEHVHLR
13268|gene|hma      ---MAARSPIMADVREVASEGTPVLGICNGAQIGCESSLTPGAFTTNESARFQCEHVHLR
513|gene|hhi        AGAMAARSPIMAEVREAASEGTPVLGICNGAQIGCESSLTPGAFTTNESARFQCEHVHLR
5010|gene|nph       AGAMAARAPIMDDVREQAEAGVPVLGVCNGAQIGSEGDLTPGAFTTNRSARFQCEPVYLR
6280|gene|hbo       AGSMAAQSPILDDVREAAADGTPVLGVCNGAQVGCESSLTEGAFTTNESARFQCEHVYLR
1945|gene|nrc1      AGAMAAQSPVVAEVRALAADGVPVLGVCNGAQIGCEAGLAPGAFTTNASARFQCERVHLR
1249|gene|hla       AGAMAARAPIMAEVREAAADGVPVIGVCNGAQIGSESGLTPGAFTTNASARFQCEPVHLR
                       ***.:*:: ::.  *  * **:*:*****:*.*..*: ******  ****** *:**

3131|gene|hwa       VENATTPWTEAYEAGTVIEIPIAHGEGRFEITENEYEMLKNDNQILFRYCDASGNITDDA
2232|gene|hut       VENSETPWTSQYEEGEVIELPIAHGEGRFEISDDRLDALEAEDRILFRYCDAEGNVTPEA
13268|gene|hma      VENADTPWTSQYEDGEVVELPIAHGEGRYEITDERLDELEAEDRILFKYCDEDGTVTPEA
513|gene|hhi        VENADTPWTSQYEDGEVVELPIAHGEGRYEISDDRLDELEAEDRILFKYCDEDGNVSPEA
5010|gene|nph       VENAETPWTEAYEDGEVIEVPIAHGEGRFEIADDELETLVDEDRVIFRYCDADGNVTDAA
6280|gene|hbo       VENAETPWTAAYEEGDVIEIPIAHGEGRFEISEDRYEQLVEEDRILFRYCDADGNVTEEA
1945|gene|nrc1      VENATTPWTAAYSEGDVLEIPIAHGEGRFEIDDDAYADLVADDRVLFRYCNADGEVTEAA
1249|gene|hla       VERADTPWTAAYDEGDVIEVPIAHGEGRFEIGEEAHADLVADDRVLFRYCDADGNVTDAA
                    **.: ****  *. * *:*:********:** ::    *  ::.::*.**: .* ::  *

3131|gene|hwa       NPNGSRGNVAGITGNYDTVAVLMPHPERATLPELGRSTDGKGILQAFG--
2232|gene|hut       NPNGSKHAVAGVTGEADHVAVMMPHPERMALADIG-GIDGRGVLSGFA--
13268|gene|hma      NPNGSKHSVAGVTGEAEHVAVMMPHPERATLSDLG-RTDGRGVLTGFAE-
513|gene|hhi        NPNGSKHSVAGVTGEDDHVAVMMPHPERATLSDLG-RTDGQGVLEGFAE-
5010|gene|nph       NPNGSKDNVAGVLGEHESVAVLMPHPERASLPDIG-PTDGQGVLEGFR--
6280|gene|hbo       NPNGSRGNVAGIRGDDENVGVLMPHPERATLPDLNGSTDGSGVLRGFETA
1945|gene|nrc1      NPNGSTGAVAGVTGDRDHVAVMMPHPERATLPALG-ATDGQGILGAFA--
1249|gene|hla       NPNGSTDNVAGVLGERESVAVLMPHPERATLPDLGRSTDGAGILRAFV--
                    *****   ***: *: : *.*:****** :*. :.   ** *:* .*