HOG Organism Gene ID Name Annotation
aHOG4103 nph NP2040 ccdA cytochrome c-type biogenesis protein
aHOG4103 hma Hma_11367 ccdA cytochrome c-type biogenesis protein CcdA
MUSCLE (3.6) multiple sequence alignment


2040|gene|nph       MEVPTLSVVFIAGVATILTPCCLPLLPPLLSGSVGHRLRPIAIVAGSLVSFTALGVVVGT
11367|gene|hma      MAAVSLLASFAAGAVTVFTPCCLPVLPPLLSGSVGHRLKPLTIVAGSIVSFTLVGLLTGY
                    * . :* . * **..*::******:*************.*::*****:**** :*::.* 

2040|gene|nph       LGSFSPDSLRTPAFLAIVAFGAVMVDDDLNRIYSTYASRLSGWLTGSFSTLDADRRPLAS
11367|gene|hma      LGTLTSDSLRAPAFLIIIAFGAVMADDDLHEAYAATASKISGRVDG-ISVLSSAAHPLAA
                    **:::.****:**** *:******.****:  *:: **.:**.: * :*.*.:  .***:

2040|gene|nph       AFSLGTLLGVIWLPCVGPVLGAVLAYAATTGAAAESGLLLFVYGTGFAVPLLGVAYGGKI
11367|gene|hma      GFTLGLVIGILWLPCVGPVLGAVLAYAGTTGDVSQSGLLLFSYGAGFGLPMLGVAYGSKV
                    .*:** ::*::****************.*** .::****** **:**.:*:******.*:

2040|gene|nph       AGRSVVSRLGAVGGTETLRRIAGGILLVTGVALLFDFDRVLLSAL
11367|gene|hma      AGGRVRDALPGVEQTETVRRLAGYLLLLSGVALLFQLDRVLLSNI
                    **  * . * .*  ***:**:** :**::******::****** :