HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0410COG1412KOG3165 KOG3164arCOG04312Uncharacterized proteins of PilT N-term./Vapc superfamilyhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0410 nrc1 VNG2054 vng2054 no entry
cHOG0410 hmu HMUK0729 Hmuk_0729 SSU processome protein Utp24
cHOG0410 hma RRNAC2828 hypothetical protein
cHOG0410 hwa HQ1336A rpo operon protein
cHOG0410 hla HLAC2397 Hlac_2397 PilT N-term
cHOG0410 hbo HBOR05050 Hbor_05050 SSU processome protein Utp24
cHOG0410 hut HUTA2208 Huta_2208 rpo operon protein
cHOG0410 hvo HVO_1900 HVO_1900 Predicted RNA-binding protein containing PIN domain
cHOG0410 nph NP5082A rpo operon protein
cHOG0410 hhi 107 HAH_0107 SSU processome protein Utp24
MUSCLE (3.6) multiple sequence alignment


1336|gene|hwa      ---------------------------MIAVILDTNALMLPVERDVRLFEELDRILTESY
2054|hp|nrc1       ---------------------------MQAVAIDTNALLLPATQPLRLFEELDRLLGD-Y
2397|gene|hla      MADDARADGPESTSAGDARPEDLAGDDAPVVALDASALMAPVEADLRLFEELDRLLGG-Y
5050|gene|hbo      ------------MTTETRHRTDSDTDATTTVVLDTNALMMPVELDVRVFDELDRLLAANV
1900|hp|hvo        -------------------------VTATVVVMDTNALMMPVELDVRVFDELDRLLAADA
5082|gene|nph      ----------------------------MRVVLDTNALMAPVEVGVRTFAELDRLLGE-Y
2208|gene|hut      ----------------------------MTAVLDTNALMMPVECNVRVFEELDRVIGE-T
12828|hp|hma       -----------------------------MIVLDTNALMMPVECNVRLFEELDRVLPDAT
107|gene|hhi       -----------------------------MIVLDTNALMMPVECNVRLFEELDRVLPDAT
                                                   :*:.**: *.   :* * ****::    

1336|gene|hwa      ISLVPRPVVAELHHLSDGAGVEATAANVGSDLLDR-CSIIDTEADFADDAIVELATTETV
2054|hp|nrc1       DAVVPQAVHDELVALAAGAGETASAASVGVDLATDRCGTLRTDVSYADDALHALAVSEDV
2397|gene|hla      EAVVPAAVVSELDRLQGGNGKEATAASVGSDLATR-AETVETEESYADDALVELVTEGRV
5050|gene|hbo      DLVVPSAVVGELEKLSAGAGNEGVAASVGADLAADRCRVVDTEATYADDAVVELAERGF-
1900|hp|hvo        DLVVPTAVLDELEKLSSGGGTEGVAASVGADLATR-CRAVETEESYADDAVVELAESGEV
5082|gene|nph      EAVVPQAVVEELESLSGGGGEEATAASVGADLAERECAVVEHNAEYADDAVVELGREAD-
2208|gene|hut      DLVVPEAVVAELDRLSDGGGEEATAASVGRDLVER-CRVVDHDATNADDAVLELARELEA
12828|hp|hma       DYVAPAAVRDELAKLADGAGAEATAASVGQDLLDR-CAIRETTADYADDAVLELAQTDDA
107|gene|hhi       DYVAPAAVRDELAKLADGAGAEATAASVGQDLLDR-CTVRETTADYADDAVLELAQADDA
                     :.* .*  **  *  * *  . **.** **    .         ****:  *      

1336|gene|hwa      LGQTEICADTTAVDSTHNHQSGEKDIGTHTNVHNNIHAGRQINVEADAHSDDRNADLIEI
2054|hp|nrc1       ------------------------------------------------------------
2397|gene|hla      ------------------------------------------------------------
5050|gene|hbo      ------------------------------------------------------------
1900|hp|hvo        ------------------------------------------------------------
5082|gene|nph      ------------------------------------------------------------
2208|gene|hut      ------------------------------------------------------------
12828|hp|hma       ------------------------------------------------------------
107|gene|hhi       ------------------------------------------------------------
                                                                               

1336|gene|hwa      SDRESTAEATTEIAEDEYSTIKQYVVTEDRPLRNRLYEHDVRVIGIRGRNTLEITEP
2054|hp|nrc1       ----------------------DAVVTNDGPLKERVLDAGTPVIHLRGRTQLTITRP
2397|gene|hla      ----------------------DGVVTNDRPLANRVLEAGAPVIGLRGRNTLAITEP
5050|gene|hbo      ----------------------DYVVTNDKPLRDRLLERGVRVIGIRGHHKLDITEP
1900|hp|hvo        ----------------------DYVVTNDKPLRDRVLDCGIPVVGIRGHATLAITEP
5082|gene|nph      -----------------------YAVTSDMPLRERLLEANVPVISLRGRTKFEITEP
2208|gene|hut      -----------------------YAVTNDGPLRQALLAADVPVIGLRGRNKLAITQP
12828|hp|hma       ----------------------THAVTNDNPLKRRLLDAGVPVISLRGRNKLGITQP
107|gene|hhi       ----------------------THAVTNDTPLKRRLLDAGVPVISLRGRNKLGITQP
                                           .**.* **   :   .  *: :**.  : ** *