HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0041COG0112KOG2467arCOG00070Glycine/serine hydroxymethyltransferaseglycine hydroxymethyltransferase

HOG Organism Gene ID Name Annotation
cHOG0041 nrc1 VNG1414 glyA glycine hydroxymethyltransferase
cHOG0041 hmu HMUK2892 Hmuk_2892 Glycine hydroxymethyltransferase( EC:2.1.2.1 )
cHOG0041 hmu HMUK2216 Hmuk_2216 Glycine hydroxymethyltransferase( EC:2.1.2.1 )
cHOG0041 hma RRNAC0999 glyA serine hydroxymethyltransferase
cHOG0041 hwa HQ2791A glyA glycine hydroxymethyltransferase
cHOG0041 hla HLAC2034 Hlac_2034 glycine hydroxymethyltransferase
cHOG0041 hbo HBOR13750 Hbor_13750 serine hydroxymethyltransferase( EC:2.1.2.1 )
cHOG0041 hbo HBOR37890b Hbor_37890 hypothetical protein
cHOG0041 hbo HBOR39860b Hbor_39860 serine hydroxymethyltransferase (EC 2.1.2.1)( EC:2.1.2.1 )
cHOG0041 hut HUTA2947 Huta_2947 Glycine hydroxymethyltransferase
cHOG0041 hut HUTA2245 Huta_2245 Glycine hydroxymethyltransferase
cHOG0041 hvo HVO_2862 HVO_2862 glyA serine hydroxymethyltransferase
cHOG0041 nph NP2050A glyA glycine hydroxymethyltransferase
cHOG0041 hhi 1625 glyA serine/glycine hydroxymethyltransferase
MUSCLE (3.6) multiple sequence alignment


37890|hp|hbo        ------------------------------------------------------------
2245|gene|hut       ----------MVTDLTPVDDELTAALAGECDRQRETLSLIASENYASDAVLAAQGSVLTN
39860|gene|hbo      --------MVGSNHLEQTDPAVYSAIQNERQRQEDSLGLIASENHVSEAVLEAQGSVLTN
1414|gene|nrc1      MARAPPPESMAYDEVREVDPEVADALTGERHRQNDTLAMIASENHVSEAVMEAQSSELTN
2791|gene|hwa       ---------MERSHIRDVDPDAADALSSERQRQEDTLAMIASENHVSEAVLEAQGSALTN
13750|gene|hbo      ---------MDYSHVRGVDPEIADALEGEEDRQRNTLAMIASENHVSEAVLQAQGSALTN
2034|gene|hla       ---------MDHEHVREVDPEVADALAGERDRQEQTLAMIASENHVSEAVLEAQGSVLTN
2050|gene|nph       ---------MNYEQVREADPAIAAALADERDRQEDTLAMIASENHVSEAVLQAQSSELTN
2947|gene|hut       ---------MDEDSVRQTDPAVADALDGERNRQEDTLAMIASENHVSEAVLEAQGSTLTN
10999|gene|hma      ---------MSYETVREADPAVADALEGERGRQNDTLAMIASENHVSEAVMEAQSSELTN
1625|gene|hhi       ---------MSYETVREADPAVADALEGERGRQNDTLAMIASENHVSEAVMEAQSSELTN
                                                                                

37890|hp|hbo        ----------MSAGTSPSGSVAEI----VEDLGGTDTVTVDL------------------
2245|gene|hut       KYAEGSPGDRYYAGCAYADEVEQLAIDRARALFDAEHANVQPHSGTSANLAAYQALLEPG
39860|gene|hbo      KYAEGYPDARYYGGCEHVDTVEQLAIDRAKELFGADYANVQPHSGTQANMGVYFAMLDPG
1414|gene|nrc1      KYAEGYPGSRYYGGCEYADDVEELAVARAKELFGADHVNVQPHSGSSANMGVYFATLAPG
2791|gene|hwa       KYAEGYPGERYYAGCEYADEIESLAIERAEELWGAEHVNVQPHSGTQANMAVYLTALDPG
13750|gene|hbo      KYAEGYPGSRYYAGCEYADEVEELAIERAKELWGAEHVNVQPHSGTQANMGVYLAVLDPG
2034|gene|hla       KYAEGYPGERYYAGCEYADEVETLAIDRAKELWGADHVNVQPHSGTQANQAVYYAVLDPG
2050|gene|nph       KYAEGYPGERYYAGCGPADDVEELAIERAEELWGAEHINVQPHSGTQANMAVYLAMLEPG
2947|gene|hut       IYAEGYPGKRYYAGCEYADDVEQLAIDRAKELWGADHVNVQPHSGSQANMGVYLAVLEPG
10999|gene|hma      KYAEGYPGERYYGGCEYADDVEELAIDRAKELWGADHVNVQPHSGSQANMGVYLGVLEPG
1625|gene|hhi       KYAEGYPGERYYGGCEYADDVEELAIDRAKELWGADHVNVQPHSGSQANMGVYLGVLEPG
                                .*    . :  :    .  * .::  .*:                   

37890|hp|hbo        ------------------------------------------------------PGVVV-
2245|gene|hut       DTILSLSLSHGGHLSHGQPYTMVDDVYDVAHYGVDVETGRLDHERVRERAEAVDPDLLVS
39860|gene|hbo      DRILSLDLTHGGHLSHGHHVNFSGQLYEVEQYGVDPDSGYIDYDTLADHATEFDPDLIVS
1414|gene|nrc1      DKILSLDLTHGGHLSHGHPANFAGQLYEVEQYEVDAETGRLDYEALREHADAFEPDMIVS
2791|gene|hwa       DKILSLDLTHGGHLSHGHPANFTGQTYTVEQYEVDPETGYIDYEGLKTKADEFNPDIIVS
13750|gene|hbo      DKILSLELSHGGHLSHGHPANFTGQTYEVEQYHVDPDTGYIDYDALAEQAEEFDPDIIVS
2034|gene|hla       DKILSLDLNHGGHLSHGHPANFTGQIYEVEQYEVDADTGYIDYEGLREAAEEFEPDIVVS
2050|gene|nph       DRILSLELEHGGHLSHGHPANFTGQTYEVEQYEVDPETGYIDYDELHEQAEAFEPDIIVS
2947|gene|hut       DKILSLDLTHGGHLSHGHPANFAGQIYEVEQYEVDAETGYLDYEGLAETAAEFEPDMIVS
10999|gene|hma      DKILSLDLTHGGHLSHGHPANFAGQVYEVEQYKVDEETGYVDYEGLHDHAEEFEPDIIVS
1625|gene|hhi       DKILSLDLTHGGHLSHGHPANFAGQVYEVEQYKVDEETGYIDYEGLHDHAEEFEPDIIVS
                                                                          *.::* 

37890|hp|hbo        ------------------------------------------------------------
2245|gene|hut       GYSAYPRQVDFEGMQAIAEAVDAVHVADIAHLTGLVAAGEHPSPVGVADVVTGSTHKTIR
39860|gene|hbo      GSSAYPREFAYERIDEIAAAVGAYHLADIAHVTGLIAAGLHTNPVGNADFVTASTHKTIR
1414|gene|nrc1      GFSAYPREVEWERIQAAADAVGALHMADIAHITGLVAAGEHASPVGVADFVTGSTHKTIR
2791|gene|hwa       GYSAYPREVEFERIQEAADLADAYHLADIAHITGLVAAGVHTSPVGVADFVTGSTHKTIR
13750|gene|hbo      GYSAYPRVVEWERIQDVAESVDAYHLADIAHITGLVAAGVHPSPVGIADFVTGSTHKTIR
2034|gene|hla       GYSAYPRTVDWEEIQAAADAVDAYHLADIAHITGLVAAGVHPSPVGVADFVTGSTHKTIR
2050|gene|nph       GYSAYPREVEFERIQEAADAVDAYHLADIAHITGLVAAGVHQSPVGVADFVTGSTHKTIR
2947|gene|hut       GYSAYPREVEWERIQDVADGADAYHLADIAHITGLVAAGVHSSPVGVADFVTGSTHKTIR
10999|gene|hma      GYSAYPREVDFERIQEAADAVDAYHLADIAHITGLVAAGVHESPVGVADFVTGSTHKTIR
1625|gene|hhi       GYSAYPREVDFERIQEAADAVDAYHLADIAHITGLVAAGVHESPVGVADFVTGSTHKTIR
                                                                                

37890|hp|hbo        --------------EAVDAAC--------------------------------------C
2245|gene|hut       AGRGGMILCGEAYADVIDRAVMPGTQGGPLMHNIAGKAAGFGEALEPEFDADAAQTIENA
39860|gene|hbo      AGRGGLILTTDEYAEQIDKAIFPGSQGGPLMHNVAGKAVGFKEALTDEFEEYAQQVVTNA
1414|gene|nrc1      AGRGGIVMCDEAFADDIDSAVFPGAQGGPLMHNIAGKAVGFNEALDPAFEEYAAQVVENA
2791|gene|hwa       AGRGGIIMCNEEHADDIDNSVFPGAQGGPLMHNVAGKAVGFKEALSDEFEAYAEQTVKNA
13750|gene|hbo      AGRGGIIMTTEEHADDVDKAIFPGAQGGPLMHNVAGKAVGFKEALEPEFEEYAERTVANA
2034|gene|hla       AGRGGIVMCDEEFADDIDKAVFPGGQGGPLMHNIAGKAVGFKEALDPSFDEYAQNVVDNA
2050|gene|nph       AGRGGIVMCDEEYADDIDAAVFPGAQGGPLMHNVAGKAVGFKEALQPEFEQYAQQVIDNA
2947|gene|hut       AGRGGVIMCDDEYADDIDSAVFPGMQGGPLMHNIAGKAVGFGEALDADFEEYAQQTVDNA
10999|gene|hma      AGRGGIIMCDEEYADDIDAAVFPGSQGGPLMHNVAGKAVGFGEALAPEFEQYAQQTVDNA
1625|gene|hhi       AGRGGIIMCDEEYADDIDSAVFPGSQGGPLMHNVAGKAVGFGEALAPEFEQYAQQTVDNA
                                  : :* :                                       .

37890|hp|hbo        AALGCRVS------------------------------------------------EPLS
2245|gene|hut       RALAARLADRGFDLVSGGTDVHFALVDFRETHPELTGAVAETALEDVGIVLNKSTVPGEE
39860|gene|hbo      KTLADTFSERGLSLVSGGTDKHYVLVDLRDSHPDVTGSDAEEALQSVGITVNKNTVPGET
1414|gene|nrc1      AVLGERLQEHGFSLVSGGTDTHLVLVDLRESHPDISGGDVEGELEDVGIVLNANTVPDET
2791|gene|hwa       EELANTLTDAGLSVVSGGTDNHLVLVDLRPSHPETTGKEVEAALESAGIIMNANTVPGET
13750|gene|hbo      KTLAETFEEAGIEVVSGGTDNHLVLADLRPSHPDTTGKDVEAALEEAGIVLNANTVPGET
2034|gene|hla       EVLAETLQDHGFSLVSGGTDNHLVLVDLRDSHPDLPGGDAADALAAANIVLNGNTVPGET
2050|gene|nph       EALGERLQEHGFSLVSGGTDNHLVLVDLRESHPDTSGTVAEEALEAAGIVLNKNTVPGET
2947|gene|hut       AALADRLQEHGLELVSGGTDNHLVLIDLRPSHPDTPGKDVEEALEDAGIVLNANTVPGET
10999|gene|hma      IALGEQFKEHGLSLVSGGTDNHLVLIDLRPSHPDTTGKEVEEALEEAGIVLNANTVPGET
1625|gene|hhi       VALGDRLKEHGLDLVSGGTDNHLVLIDLRPSHPDTTGKEVEEALEEAGIVLNANTVPGET
                      *.  .                                                     

37890|hp|hbo        RVTIDGFGTRVLCP------------DHVEHLIEREVEA---------------------
2245|gene|hut       RSSTVTSGIRIGTPAITTRGFDAAATRRLADAIADVCDAPDDDGVREQARETVADLAEAH
39860|gene|hbo      RSPFTTSGIRVGTPALTTRGFTQSEMETIGHAIVDIIEHPEDDDVATDVATTVDQLCEAY
1414|gene|nrc1      RSAFDPSGIRIGTPALTTRGFDADAMETVADCIARVIDNLGDESVYADVADTVADLCEQY
2791|gene|hwa       RSAFNPSGIRVGTPALTTRGFTESTVREVGELMIELIDDPTDDEAIAAVSDRVDTLTDEY
13750|gene|hbo      RSAFNPSGIRAGTPGLTTRGFDEAAVREVGELIVRVVDNYDDEETIESVAERVQELCDEH
2034|gene|hla       RSPFNPSGIRVGTAGVTTRGFDADVMEEVGDLIHRVVDNVDSDDVIYEVGERVVELCDEH
2050|gene|nph       RSAFNPSGIRAGTPALTTRGFDEQACERVADIIANVIDNPDDEGTIDEAAAEVDALCEEY
2947|gene|hut       RSAFNPSGIRAGTPGLTTRGFDEDACREVADLIYEVVDAPDDEGVIAEVSERVDELTDEY
10999|gene|hma      RSAFNPSGIRAGTPALTTRGFDEDACREVADLIYKVVDAPHDDDVVAEVSDRVDEMTDEY
1625|gene|hhi       RSAFNPSGIRAGTPGLTTRGFDEDACREVADLIYEVVDAPHDDDVVAKVSDRVDELTDEY
                    * .    * *   .              :   :    :                      

37890|hp|hbo        -------------
2245|gene|hut       PIYA---------
39860|gene|hbo      PIYE---------
1414|gene|nrc1      PQYE---------
2791|gene|hwa       PLYR---------
13750|gene|hbo      PLYE---------
2034|gene|hla       PLYE---------
2050|gene|nph       PLYQGESGITDFE
2947|gene|hut       PLYDD--------
10999|gene|hma      TLYE---------
1625|gene|hhi       TLYE---------