HOG Organism Gene ID Name Annotation
aHOG4092 nph NP2038 abc29a ABC-type transport system ATP-binding protein
aHOG4092 hma Hma_11368 trp-6 ABC transporter ATP-binding protein
MUSCLE (3.6) multiple sequence alignment


2038|gene|nph       MSFVSVAGLSKRFGSHLAVDDVSFELTAGETAVLFGPNGAGKTTLIRMLASLARPSDGTI
11368|gene|hma      MAFLSLSTVSKYFGPKVGVEGITIDVSRGETVLLFGHNGSGKTTLLRLLATLTRPSEGTI
                    *:*:*:: :** **.::.*:.:::::: ***.:*** **:*****:*:**:*:***:***

2038|gene|nph       RIDGQPLVGD-DAARGDIGVLTHETLLYEELTARENLRLHARLHGVDEAICEELLETVGL
11368|gene|hma      SLQGTEFSRDRPTQRGELGFVAHETYLYEQLTALENLRLHARLHGVDPNRCEAQLDAVGL
                     ::*  :  *  : **::*.::*** ***:*** *************   **  *::***

2038|gene|nph       AARGSERVSGFSHGMAKRVSLARALVHDPALLLLDEPYTGLDQTSLKRMTTVLSELADRT
11368|gene|hma      TDRGTDPVSEFSHGMAKRLALARATLHDPALLLLDEPFTGLDEESLLRVTDQLRELEETT
                    : **:: ** ********::**** :***********:****: ** *:*  * ** : *

2038|gene|nph       VLASTHDLERGVELADRILFMREGRLVGDAAADEFETVEGAVDRYETLCGGEPAVGGALR
11368|gene|hma      VVFATHDVDRGFRYADRVLVLDGGQLVRDIDTAECPGPDAIKQQYVN----APRQS----
                    *: :***::**.  ***:*.:  *.** *  : *    :.  :.* .     *  .