HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0409COG0113KOG2794arCOG04300Delta-aminolevulinic acid dehydrataseporphobilinogen synthase

HOG Organism Gene ID Name Annotation
cHOG0409 nrc1 VNG2322 hem2 porphobilinogen synthase
cHOG0409 hmu HMUK0925 Hmuk_0925 Porphobilinogen synthase( EC:4.2.1.24 )
cHOG0409 hma RRNAC2610 hemB delta-aminolevulinic acid dehydratase
cHOG0409 hwa HQ3443A hemB delta-aminolevulinic acid dehydratase
cHOG0409 hla HLAC0015 Hlac_15 delta-aminolevulinic acid dehydratase
cHOG0409 hbo HBOR01350 Hbor_01350 porphobilinogen synthase( EC:4.2.1.24 )
cHOG0409 hut HUTA1362 Huta_1362 Porphobilinogen synthase
cHOG0409 hvo HVO_0087 HVO_0087 hemB delta-aminolevulinic acid dehydratase
cHOG0409 nph NP0920A hemB delta-aminolevulinic acid dehydratase
cHOG0409 hhi 3030 hemB delta-aminolevulinic acid dehydratase
MUSCLE (3.6) multiple sequence alignment


2322|gene|nrc1      --MELPHRPRRLRRDGVRDLVSETMLTPADLVAPVFVDATADERTPIPSMPGQERVPLAD
3443|gene|hwa       MNIELTDRPRRLRRDGIRSLVSETSVTAQDLVAPVFIDATTTTRTPIESMPGHERVPIED
15|gene|hla         --MHPTDRPRRLRTDGARSLVSETSLSASDLVAPVFVDATTDERVPIETMPGHERVPVDE
920|gene|nph        --MDLTDRPRRLRADGVRDLVSETELHASDLIAPIFVDATTDERVEIESMPGHERVPVEE
1362|gene|hut       --MNHPNRPRRLRTDGIRPLVSETTLDASDLIAPVFIDATTDERVPIETMPGHERVPVEQ
1350|gene|hbo       --MNLTDRPRRLRTDGIRSLVSETNLSATDLIAPVFVDATTDERLPIESMPGHERVPVSE
12610|gene|hma      --MNLTQRPRRLRTDGVRPLVRETELTASDLIAPVFVDATTDERVPIETMPGHERVPIEE
3030|gene|hhi       --MNLTQRPRRLRTDGVRPLVRETELSASDLIAPVFVDATTDERVPIETMPGHERVPVGE
                      :  . ****** ** * ** ** : . **:**:*:***:  *  * :***:****: :

2322|gene|nrc1      AVDRTREILDTGVEAIVLFGIPASKDDTGSRAYADDGIVQEATRRITSETDAYVITDVCL
3443|gene|hwa       AVTRVEEIRETGVEAVMVFGIPAEKDERGSRAWASDGVVQQAVRRITAETDAYVITDVCL
15|gene|hla         AVARVEEVRETGVEAVIVFGIPESKDAEGTRAYAEDGVVQRAIRRITAETDAYVIGDVCL
920|gene|nph        AVPRTEEVLSTGVESVIVFGVPESKDSEGSRAWADDGVVQRAVRAITDETDAYVITDVCF
1362|gene|hut       AVERVQEIRETGVEAIIVFGVPESKDSEGSRAWADDGVVQKAVRRITAETDAYVITDVCM
1350|gene|hbo       AVARVEEVLETGVEAVMLFGIPESKDERGSRAWAEDGVVQKATRRVTEETDAYVITDVCM
12610|gene|hma      AVDRVEEVLETGVEAVMLFGIPESKDERGSRAWAEDGVVQEATRRISGETDAYVITDVCL
3030|gene|hhi       AVERVEEVLETGVEAVMLFGVPESKDERGSRAWAEDGVVQEATRRISGETDAYVITDVCL
                    ** *. *: .****::::**:* .**  *:**:*.**:** * * :: ******* ***:

2322|gene|nrc1      CEYTSHGHCGVVEADADTDPTLTVKNDETLSLLAETAVSHAEAGAEMIAPSAMTDGMVDA
3443|gene|hwa       CEYTTHGHCGVVESDAATDPTLTVKNDKTLELLIKTAVSHVEAGAEMVAPSSMTDGMITA
15|gene|hla         CEYTDHGHCGVIEESAETDPTLTVKNDETLELLAETAVSQADAGADMVAPSAMTDGQVRA
920|gene|nph        CEYTDHGHCGILESDAAEDPHLTMDNDATLELLRRTAVSHAEAGADMVAPSGMVDGMVGA
1362|gene|hut       CEYADHGHCGLLEDDARQDPVLTVRNDETLDALARTAVSHAAAGADMVAPSAMMDGMVGA
1350|gene|hbo       CEYTSHGHCGIVEDHAESDPTLTVKNDETLALLAKTAVSHAEAGADMVAPSSMTDGMVGA
12610|gene|hma      CEYTDHGHCGVLEDGAAENPRLTVRNDETLDLLGKIAASHAAAGADMVAPSGMIDGMVGA
3030|gene|hhi       CEYTDHGHCGVLEDDAAENPRLTVRNDETLDLLGKIAASHAAAGADMVAPSGMIDGMVGA
                    ***: *****::*  *  :* **: ** **  *   *.*:. ***:*:***.* ** : *

2322|gene|nrc1      IRTALDDAGFSDVPIMSYAAKYESAFYGPFRDAADGAPSFGDRRHYQMDPANRREASREV
3443|gene|hwa       IRTALDETGHTDIPIMSYAAKYESAFYGPFRDAADGAPAFGDRRHYQMDPANSQEAKREV
15|gene|hla         IREALDAAGHADVGLMSYAVKYESAFYGPFRDAADGAPAFGDRRHYQMDPANRREALREA
920|gene|nph        IRNALDAAGYEQIPVMSYAAKYESAFYGPFRDAADGAPSFGDRRHYQMDPANAREARREV
1362|gene|hut       IREGLDDAGHTEVPIMSYAAKYESAFYGPFRDAADGAPAFGDRRHYQMDPANAREAMREV
1350|gene|hbo       IREALDESGHESVPIMSYAAKYESAFYGPFRDAADGAPAFGDRRHYQMDPANAREAIREV
12610|gene|hma      IRTALDADGFDDVAIMSYAAKYESAFYGPFRDAADGAPAFGDRRHYQMDPANAREASREV
3030|gene|hhi       IREALDAQGDTDVPVMSYAAKYESAFYGPFRDAADGAPAFGDRRHYQMDPANAREASREV
                    ** .**  *  .: :****.******************:************* .** **.

2322|gene|nrc1      ALDVEQGADVLMVKPALPYLDVVSDVRREFDRPVAAYNVSGEYAMLHAAAEKGWLDLESV
3443|gene|hwa       RLDVEAGADVLMVKPALAYLDIVNTVSSNFDRPVAAYNVSGEYAMVHAAADRGWVDLEAT
15|gene|hla         RIDAEEGADVLMVKPGLPYLDIVGDLRREFDHPIAAYNVSGEYAMLHAAAEKGWLDLEAT
920|gene|nph        RLDVEQGADVLMVKPALPYLDIVSELRREFDRPVAAYNVSGEYAMLHAAADRGWLDRQSV
1362|gene|hut       TLDVEEGADVLMVKPALPYLDIVRDVRERFDQPVAAYNVSGEYAMLHAASEQGWLDLEAT
1350|gene|hbo       TLDVEQGADVLMVKPALAYLDIVRAVREEFDHPVAAYNVSGEYAMLHAAAEKGWMDLDET
12610|gene|hma      DLDVEQGADVLMVKPALPYLDIVKEVRESYDHPVAAYNVSGEYAMLHAAAEKGWLDLEAV
3030|gene|hhi       DLDVEQGADVLMVKPALPYLDIVKEIRESYDHPVAAYNVSGEYAMLHAAAEKGWLDLEAV
                     :*.* *********.*.***:*  :   :*.*:***********:***::.**:* : .

2322|gene|nrc1      AHESLLSIKRAGADLIITYFAEDVAETL----
3443|gene|hwa       AVESLIAMKRAGADLIITYFAEKLANQL----
15|gene|hla         AHESLLSLKRAGADLIITYFAEDLAERL----
920|gene|nph        AHESLLSIKRAGADLILTYFAESVAERL----
1362|gene|hut       AYESLLSIKRAGADLILTYFAEDVAGAL----
1350|gene|hbo       AFESLLAMKRAGADLILTYFAEDIADAL----
12610|gene|hma      AYESLLSIKRAGADLILTYFAEDLADEL----
3030|gene|hhi       AYESLLSIKRAGADLILTYFAEDLADELYSNN
                    * ***:::********:*****.:*  *