HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0408COG1363arCOG01518Cellulase M and related proteinsendoglucanase

HOG Organism Gene ID Name Annotation
cHOG0408 nrc1 VNG1498 celM endoglucanase
cHOG0408 hmu HMUK2098 Hmuk_2098 peptidase M42 family protein( EC:3.2.1.4,EC:3.2.1.6 )
cHOG0408 hma RRNAC0799 cdlM endoglucanase
cHOG0408 hwa HQ2923A celM cellulase; endo-1,3(4)-beta-glucanase
cHOG0408 hla HLAC2235 Hlac_2235 hypothetical protein
cHOG0408 hbo HBOR12270 Hbor_12270 peptidase family protein( EC:3.2.1.6,EC:3.2.1.4 )
cHOG0408 hut HUTA0675 Huta_0675 peptidase M42 family protein
cHOG0408 hvo HVO_2759 HVO_2759 TET aminopeptidase homolog
cHOG0408 nph NP4306A celM cellulase; endo-1,3(4)-beta-glucanase
cHOG0408 hhi 1445 celM endoglucanase/peptidase M42 family protein
MUSCLE (3.6) multiple sequence alignment


2235|hp|hla         --------------MTTEASGTNMNTKVARVIREY--------DLDGM-----------G
1498|gene|nrc1      ---MDDARRTFLDELLAVHSPTGHEAAAQRVWVEYVSQYADRVETDAYGNAVAVAE---G
2923|gene|hwa       ---MDDTRREFLTDLLTTPSPSGFETVGQRVWVKYVQQFADEVNTDAYGNAVAVYHGDPA
12270|gene|hbo      ---MDDTRRTFLKDLLTTPSPSGYEADGQRVWVSYVEEFADEVRVDDYGNAVAVHEGT-G
4306|gene|nph       ---MDETRRAFLDELLSESTPSGFETAGQRRWLDYVSEFADETRVDDYGNAVAVYEGD-P
675|gene|hut        ---MDDPQRDFLESLLDTASPSGFETPGQRVWIEYVSQFADNVRTDDYGNAVAVHEG--D
10799|gene|hma      MLHMDTRRREFLESLLTTPGPSGYEADSQRVWLDYVSEFADEVRTDDYGNAVAKVE---G
1445|gene|hhi       ---MDTRRREFLESLLTTPGPSGYEADSQRVWLDYVSEFADEVRTDDYGNAVAKVE---G
                                  :      :. ::   *   .*          *              

2235|hp|hla         ANLEAAWTGEAGE-RTSLRDLAD------------------------EFNEAVLEAALRE
1498|gene|nrc1      GAPAVAFTGHADEIGFAVAEITEGGFVRIAPIGGLDASVTRGSQVRIETDDGPVNGVIGQ
2923|gene|hwa       CDVSIAFAGHADEIGYIIRDITDDGYLRINRIGGADRTVSKGQHVTVHS-ETPVAGVIGQ
12270|gene|hbo      GGPEIAFTGHADEIGYIVRDVTDDGFLRIAAIGGADRTVSKGQHVTVHAADGEVPGVIGQ
4306|gene|nph       DAPSIAVAGHSDEIGLMVRDITDDGFLKLTRIGGSDRTVTRGKHVTVHADDGPVSGVIGQ
675|gene|hut        GDREIAIAGHGDEIGFMVRDITDDGFIELSRIGGSDRTVTRGQHVTVHTDAGPVSGVVGQ
10799|gene|hma      GDTTVALAGHGDEIGFIVRDFTDDGFVKLGRIGGSDKTVSRGQHVTIHTADGPVSGVVGQ
1445|gene|hhi       GDTTVALAGHGDEIGFIVRDLTDDGFVKLGRIGGSDKTVSRGQHVTIHTADGPVSGVVGQ
                         * :* ..*    : :.::                              : ..: :

2235|hp|hla         SGISSLSVDVSTTYEAL--------------------RGESGSAATRARR----RLEREG
1498|gene|nrc1      AAVHLRDHSEDGAAPSVTEQYVDIGAADGDDARDRVSVGDPGVLVSEPRELAGGRLNARS
2923|gene|hwa       TAIHLRDTGNE-SYDDIDEQFIDIGAEDGDAARERVEVGDPVTVETRVRPLADTRLAARA
12270|gene|hbo      TAIHLRDVGEE-EYDDLEEQFVDIGAADEAEAHELVEVGDPLTVETRVRDLHGSRMAARG
4306|gene|nph       VAIHLRDTGSE-EYDDINEQYVDIGVEDGDRAEELVDIGDPITLNTEIADLEDSRVAARG
675|gene|hut        TAIHLRDREDD-SIDDVAEQHVDIGVSDGESARERVEIGDPVTFASGLESLAGTRLSARG
10799|gene|hma      TAIHLRDSDDD-SVPEISEQHVDVGAVDGDEVESLVDRGDPVTFVQTLSELENGRLAARG
1445|gene|hhi       TAIHLRDSDDD-SVPEIAEQHVDVGAEDGDEVESLVDRGDPVTFVQTLSELENGRLAARG
                     .:   .   .     :                     *:.             *:   .

2235|hp|hla         VDVDELTGDFVTHQAIHTYLTQ--EREASLPAA---------------------------
1498|gene|nrc1      LD--NRTGLWVAAEGFRRAVER--DVDATVYAVSTVHEEIGTRGARMVGFDLDVDAVVAA
2923|gene|hwa       LD--NRVGIWAAAEALRAAATRTQSVDATVYAVSTVQEEVGVQGAKMVGFDLDPDAAVAI
12270|gene|hbo      MD--NRVGTWAAAEALRHAVEA--DVDATVYAVSTVQEELGVQGAKMVGYDLNPDAAVAI
4306|gene|nph       MD--NRVGVWTAAEAFRRAVEQ--EPDATIYAVSTVQEEVGLKGAQMVGFDVAPDAAIAA
675|gene|hut        MD--NRVGIWTAAEALRTASDA--DASATVYAVSTVQEELGLQGAKMVGFDLDPDAVVAV
10799|gene|hma      MD--NRIGIWAAAEGLRRAAES--DADATVYAVSTVQEEVGVQGAKMVGFDLAPDVAIAA
1445|gene|hhi       MD--NRIGIWAAAEGLRRAAEA--GADATVYAVSTVQEEVGVQGAKMVGFDLAPDVAIAV
                    :*  :  * :.: :.:.         .*:: *.                           

2235|hp|hla         -------DDDMADRKVETIEKLQGRVSAVAESAISSLANAGELDRGDYDVLVDVRAVCPN
1498|gene|nrc1      DVTHAADDPMYPAERASTVALGDGPVVMRGGTNHPVVVSALRDAAADAGASLQVAAHRIS
2923|gene|hwa       DVTHATDNPDLPGNSVGPVELGSGPVVTRGSVNHPTLVTLARDAAETAEVDVQLQAAGSR
12270|gene|hbo      DVTHATDNPDVESKHKGPVELGEGPVITRGSANHPAVVELARNAANDADVDVQLQAAGIR
4306|gene|nph       DVTHATDQPESPGDKGSGIELGSGPAVARGSTNHPKLVEAARTAADDADIDIQLAAAGSR
675|gene|hut        DVTHATDTPDVPGKRSNGVELGAGPVVARGSANHPQLVESLRSVADEENVDVQLEATGIR
10799|gene|hma      DVTHATDAPGSPGKAATGVELGEGPVVARGSANHPVAVDALRETSDAEDIDIQLQATGIR
1445|gene|hhi       DVTHATDSPGSPGKADTGVELGAGPVVARGSANHPVAVDALRETGKEEDIDIQLQATGSR
                                      :    * .   .    .  .             ::: *    

2235|hp|hla         CGTDAPVGELIRRGGCGCTS------------------------------EAETDDE---
1498|gene|nrc1      TGTDAD-AFGTAGGGVPTADLGIPNRYMHTPAEVVDLADLAAGADVLAAFAAHAGDRDSF
2923|gene|hwa       TGTDAD-AFYTSRSGIPALNIGIPNRYMHTPVEVIDTTDLDAIASLTGAMAAGADDIAPF
12270|gene|hbo      TGTDAD-AFYTSRSGIPSLNIGIPNRYMHTPVEVVDTEDLDAIATLLGSMAVGAEDAAPF
4306|gene|nph       TGTDAD-AFYISRGGIPSLNLGLPNRYMHTPVEVIDLDDLDAAADLLAAVAARADEFAPF
675|gene|hut        TGTDAD-AFYTQRGGVPSVNLGLPNRYMHTPVEVIDTADLTNAATLLGAFAVAAESLAPF
10799|gene|hma      TGTDAD-AFYTSRGGIPSVNVGLPNRYMHTPVEVIDPDDLDALADLLAGFAVRAAEQAPF
1445|gene|hhi       TGTDAD-AFYTSRGGIPSVNVGLPNRYMHTPVEVIDPDDLDVLADLLAGFAVRAADRAPF
                     ****  .     .*    .                               . : .    

2235|hp|hla         ----------
1498|gene|nrc1      GVSV------
2923|gene|hwa       TLDV------
12270|gene|hbo      GVNV------
4306|gene|nph       SVDI------
675|gene|hut        GVEFDTESRA
10799|gene|hma      SVDV------
1445|gene|hhi       SVDV------