HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0407COG1095KOG3298 KOG3297arCOG00675DNA-directed RNA polymerase subunit E'DNA-directed RNA polymerase subunit E'

HOG Organism Gene ID Name Annotation
cHOG0407 nrc1 VNG2053 rpoE' DNA-directed RNA polymerase subunit E'
cHOG0407 hmu HMUK0728 Hmuk_0728 DNA-directed RNA polymerase( EC:2.7.7.6 )
cHOG0407 hma RRNAC2829 rpoE' DNA-directed RNA polymerase subunit E'
cHOG0407 hwa HQ1337A rpoE1 DNA-directed RNA polymerase subunit E'
cHOG0407 hla HLAC2396 Hlac_2396 DNA-directed RNA polymerase
cHOG0407 hbo HBOR05040 Hbor_05040 DNA-directed RNA polymerase, subunit E'( EC:2.7.7.6 )
cHOG0407 hut HUTA2207 Huta_2207 DNA-directed RNA polymerase
cHOG0407 hvo HVO_1899 HVO_1899 rpoE DNA-directed RNA polymerase
cHOG0407 nph NP5080A rpoE1 DNA-directed RNA polymerase subunit E'
cHOG0407 hhi 108 rpoE' DNA-directed RNA polymerase subunit E'
MUSCLE (3.6) multiple sequence alignment


2396|gene|hla       MYKRVRLKDTVEVPPKHLADVTDERVKALLQDKLEGRMDEDVGSVVSVIEVHDIGDGAVL
2053|gene|nrc1      MYKRARLKDTIEVPPEYLGAVGPDLVKRLLQDKLEGRMDEDVGSIVTVTEVHDLGEGAVL
1337|gene|hwa       MYKRVQLTDTVEVPPRHLADVTPQRVKRLLQDKLEGRMDEDIGSVVSVISVLDIGEGAVL
5040|gene|hbo       MYKRVRLKDTVEVPPEHLADVTPQRVKRLLQDKLEGRMDEDVGSVVSVVNVHDIGEGTVL
5080|gene|nph       MYKRVRLKDTVEVPPRHLADVSPELVKRLLQDKLEGQMDEDVGSIVSVTAVHDIGDGAVL
12829|gene|hma      MYKRVRLRDTVEVPPRFLAEVSPGLVKRLLQEKLEGRMDEDVGSVVSVIEVHDIGTGAVL
108|gene|hhi        MYKRVRLRDTVEVPPRFLAEVSPGLVKRLLQEKLEGRMDEDVGSVVSVIEVHDIGTGAVL
2207|gene|hut       MYKRVRLRDTVEVPPEHLADVTPGLVKRLLQEKLEGRMDEDVGSVVSVTEVHDIGEGAVV
                    ****..* **:**** .*. *    ** ***:****.****:**:*:*  * *:* *:*:

2396|gene|hla       HNRPGVYYEAEFDALTYDPDMQEVADGTVVETVEFGAFVGIGPVDGLLHVSQITDEYLTF
2053|gene|nrc1      PNRPGVYYEAEFDAVTFEPEMQEVVDGEVVEVVSFGAFVGIGPVDGLLHVSQISDEYLAF
1337|gene|hwa       PGRAGVYYEAKFDAITFDPAMQEVVDGEVVEVVEFGAFVGIGPVDGLLHVSQISDEYLAY
5040|gene|hbo       PGRAGVYYEAEFDAVTFDPDMQEVIDGEVVEVVEFGAFVGIGPVDGLLHVSQISDEYLAY
5080|gene|nph       PNRPGVYYEAEFDAVTFDPQMQEVVDGEVVEVVNFGAFVGIGPVDGLLHVSQISDEYLAY
12829|gene|hma      PNKPGVYYEAEFDALTFDPQMQEVVDGEVVEVVNFGAFIGIGPVDGLLHVSQISDEYLAY
108|gene|hhi        PNKPGVYYEAEFDALTFDPQMQEVVDGEVVEVVNFGAFIGIGPVDGLLHVSQISDEYLAY
2207|gene|hut       PNEPGVYYVAEFDALTFDPQMQEVVDGEVVEVVNFGAFVGIGPVDGLLHVSQISDEYLAY
                     . .**** *:***:*::* **** ** ***.*.****:**************:****::

2396|gene|hla       DGVNQQLASSDSDKTLGVDDAVRVRVVTKSIDERNPRDSKIGLTAKQPGLGKHEWLEGQR
2053|gene|nrc1      DEENQQLASRESNQVLGTGDSVRARIVTKSIDERNPRESKIGLTAKQPGLGKHGWLQADR
1337|gene|hwa       DGENQQLASTESNRTLGVGDSVRVRVVTKSIDERNPRDSKIGLTAKQPGLGKHGWLQADR
5040|gene|hbo       DGENQQLASTESNRTLAVGDSVRVRVVTKSIDERNPRDSKIGLTAKQPGLGKHGWLEADR
5080|gene|nph       DEENQQLASRDSNRVLSVGDSVRARIVTKSIDERNPRDSKIGLTAKQPGLGKHGWLEEER
12829|gene|hma      DEENQQLASRESNRTLTVGDAVRARIVTKSIDERNPRDSKIGLTAKQVGLGKHGWLQEER
108|gene|hhi        DEENQQLASRESNRTLTVGDAVRARIVTKSIDERNPRDSKIGLTAKQVGLGKHGWLQEER
2207|gene|hut       DGENQQLASRDSNRTLTVGDSVRARIVTKSIDERNPRDSKIGLTAKQVGLGKHGWLDEER
                    *  ****** :*:..* ..*:**.*:***********:********* ***** **: :*

2396|gene|hla       QHREQTGEEAD---
2053|gene|nrc1      EQADAASEGE----
1337|gene|hwa       QANAATTEAGAEGK
5040|gene|hbo       QASEATTEAEGR--
5080|gene|nph       QRRE--AQAGD---
12829|gene|hma      ERREGTAEAGDS--
108|gene|hhi        ERREGTAEAGDS--
2207|gene|hut       KAR---AEAGEN--
                    :      :