HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0406COG0206arCOG02201Cell division GTPasecell division protein

HOG Organism Gene ID Name Annotation
cHOG0406 nrc1 VNG0376 ftsZ1 cell division protein
cHOG0406 hmu HMUK2935 Hmuk_2935 cell division protein FtsZ
cHOG0406 hma RRNAC0703 ftsZ1 cell division protein FtsZ
cHOG0406 hwa HQ1243A ftsZ cell division protein FtsZ
cHOG0406 hla HLAC0901 Hlac_901 cell division protein FtsZ
cHOG0406 hbo HBOR25000 Hbor_25000 cell division protein FtsZ
cHOG0406 hut HUTA0895 Huta_0895 cell division protein FtsZ
cHOG0406 hvo HVO_0717 HVO_0717 ftsZ cell division protein FtsZ
cHOG0406 nph NP0810A ftsZ_1 cell division protein FtsZ
cHOG0406 hhi 1352 ftsZ3 cell division protein FtsZ
MUSCLE (3.6) multiple sequence alignment


376|gene|nrc1       MDSIVQDAIDEAEE---SEDSASEPA-------------DVAGGGGDTVPTGTMTDNELE
1243|gene|hwa       MDSIVDDAIDEAEK---TGGGDAVDGAAVEAEPESESTADTGATNDGLSQSGTMTDDELQ
901|gene|hla        MDSIVEDAIDEAEESPVDDSGEAGAG-------------ENGATAGAPPQTGTMTDDELQ
25000|gene|hbo      MDSIVDDAIDEAEE---TGDGRTVGG-------------LENDSEQI-RRSGTMTDEELK
717|gene|hvo        MDSIVGDAIDEAEA---EDMGDESAQ-------------VDG-AANI-NRSGTMTDDELK
810|gene|nph        MDSIIEDAIDEAEEDGEASSGDATPT----------DSADAGTTDADVKSSGTMTDEELA
10703|gene|hma      MDSIIDDAIDEAEQDGEDAAGGTVDE-------------TTSTPSQDMSTSGTMSDEELA
1352|gene|hhi       MDSIIDDAIDEAEQDGEDAAGGTVDE-------------TTSTPSQDMSTSGTMSDEELA
895|gene|hut        MDSIIDDAMEEADDDPEESPVEGNDE-------------PTDTAAEEPATSGQMTDEELA
                    ****: **::**:                                     :* *:*:** 

376|gene|nrc1       DVLQELQTNITVVGCGGAGSNTVDRMATEGIHGADLVAANTDVQHLV-DIEADTKILMGQ
1243|gene|hwa       DVLEDLQTDITVVGCGGAGGNTVDRMHQEGIEGATLVAANTDVQHLV-EIESDTKILMGE
901|gene|hla        DVLQDLQTNITVVGCGGAGGNTVNRMTEEGIHGAKLVAANTDVQHLV-NIEADTKILMGQ
25000|gene|hbo      NVLQDLQTDITVVGCGGAGGNTVNRMHEEGIKGAKLVAANTDVQHLV-EIDADTKILMGE
717|gene|hvo        AVLKDLQTNITVVGCGGAGGNTVNRMHEEGIKGAKLVAANTDVQHLV-EIGADTKILMGE
810|gene|nph        SVVKDLQTKITVVGCGGAGGNTVTRMAEAGIHGAKLVAANTDAQHLATEVEADEKILIGR
10703|gene|hma      SVVKDLETKITVVGCGGAGGNTVTRMMEEGIHGAKLVAANTDAQHLADEVAANTKILIGR
1352|gene|hhi       SVVKDLETKITVVGCGGAGGNTVTRMMEEGIHGAKLVAANTDAQHLADEVAADTKILIGR
895|gene|hut        DVVEDLETKITVVGAGGAGGNTVTRMMEEGIHGAKLVAANTDAQHLADEVKADTKILIGK
                     *:::*:*.*****.****.*** **   ** ** *******.***. :: :: ***:* 

376|gene|nrc1       QKTKGRGAGSLPQVGEEAAIESQGEIRDSIAGSDMVFVTAGLGGGTGTGSAPVVAKAARE
1243|gene|hwa       QKTQGRGAGSLPQVGEEAAIESQEEIYNAIEGSDMVFVTAGLGGGTGTGSAPVVAKAARE
901|gene|hla        QKTQGRGAGSLPQVGEEAAIESQEEIQDAIDGSDMVFVTAGLGGGTGTGSAPVVAKAARE
25000|gene|hbo      QKTQGRGAGSLPQVGEEAALESQEEIYDAIEGSDMVFVTAGLGGGTGTGSAPVVAKAARE
717|gene|hvo        QKTQGRGAGSLPQVGEEAALESQEEIYDAIEGSDMVFVTAGLGGGTGTGSAPVVAKAARE
810|gene|nph        QRTGGRGAGSVPKIGEEAAQENLEDITNSIDGSDMVFITAGLGGGTGTGSAPVVAQAAQD
10703|gene|hma      KRTGGRGAGSVPKIGEEAAQEDIEDIQQSIDGSDMVFVTAGLGGGTGTGAAPVVAQAAQE
1352|gene|hhi       KRTGGRGAGSVPKIGEEAAQEDIEDIQQSIDGSDMVFVTAGLGGGTGTGAAPVVAQAAQE
895|gene|hut        KRTGGRGAGSVPKIGEEAAQENIEDIQQSIDGSDMVFVTAGLGGGTGTGAAPVIAQAAQD
                    :.* ******:*::***** *.  :* ::* ******:***********:***:*:**.:

376|gene|nrc1       QGALTIAIVTTPFTAEGEVRRTNAEAGLERLRDVADTVIVVPNDRLLDSVGKLPVREAFK
1243|gene|hwa       SNALTIAIVTTPFTAEGEVRRTNAEAGLERLRDVADTVIVVPNDRLLDSVGKLPVRQAFK
901|gene|hla        SGALTIAIVTTPFTAEGEVRRTNAEAGLERLRDVSDTVIVVPNDRLLDSVGKLPVRQAFK
25000|gene|hbo      CGALTIAIVTTPFTAEGEVRRTNAEAGLERLRDVADTVIVVPNDRLLDAVGKLPVRQAFK
717|gene|hvo        SGALTIAIVTTPFTAEGEVRRTNAEAGLERLRDVSDTVIVVPNDRLLDAVGKLPVRQAFK
810|gene|nph        QGALTIAIVTIPFTAEGERRRANADAGLERLRAVADTVIVIPNDRLLDYAPNMPLQDAFK
10703|gene|hma      AGALTISIVTIPFTAEGERRRANADAGLERLRSVSDTVIVVPNDRLLDYAPSMPLQDAFK
1352|gene|hhi       AGALTISIVTIPFTAEGERRRANADAGLERLRSVSDTVIVVPNDRLLDYAPSMPLQDAFK
895|gene|hut        SGALTISIVTIPFTAEGERRRANADAGLERLRAVSDTVIVVPNDRLLDYAPSMPLQDAFK
                     .****:*** ******* **:**:******* *:*****:******* . .:*:.:***

376|gene|nrc1       VSDEVLMRSVKGITELITKPGLVNLDFADVRTVMEKGGVAMIGLGEADSDAKAADSVQSA
1243|gene|hwa       VSDEVLMRSVKGITELITKPGLVNLDFADVKTVMQRGGVAMIGLGESDSESKAQDSVKSA
901|gene|hla        VSDEVLMRSVKGITELITMPGLVNLDFADVRTVMEKGGVAMIGLGESDSDSKAQDSVKSA
25000|gene|hbo      VSDEVLMRSVKGITELITKPGLVNLDFADVKTVMERGGVAMIGLGESDSDSKAQDSVKSA
717|gene|hvo        VSDEVLMRSVKGITELITKPGLVNLDFADVKTVMERGGVAMIGLGESDSESKAQESVKSA
810|gene|nph        ICDRVLMRSVKGMTELITKPGLVNVDFADVKTIMENGGVAMIGLGESDSENKAQDSIRSA
10703|gene|hma      ICDRVLMRSVKGMTELITKPGLVNVDFADVRTIMENGGVAMIGLGESDSENKAQDSIRSA
1352|gene|hhi       ICDRVLMRSVKGMTELITKPGLVNVDFADVRTIMENGGVAMIGLGESDSENKAQDSIRSA
895|gene|hut        ICDRVLMRSVKGMTELITKPGLVNVDFADVRTIMENGGVAMIGLGESDSENKAQDSIRSA
                    :.* ********:***** *****:*****.*:*:.**********:**: ** :*:.**

376|gene|nrc1       LRSPLLDVDISSANSALVNVTGGPGMSIEEAEGVVEQLYDRIDPDARIIWGTSIDEQIQE
1243|gene|hwa       LRSPLLDVDISSANSALVNVAGGSDMSIEEAEGVVEEIHNRIHPDARIIWGTSVDDDLDG
901|gene|hla        LRSPLLDVDISSANSALVNVTGGTDMSIEEAEGVVEEIYDRIDPDARIIWGTSVDEELEG
25000|gene|hbo      LRSPLLDVDISGANSALVNVTGGSDMSIEEAEGVVEEIYDRIDPDARIIWGTSVDEELDG
717|gene|hvo        LRSPLLDVDISGANSALVNVTGGSDMSIEEAEGVVEEIYDRIDPDARIIWGTSVDDELEG
810|gene|nph        LRSPLLDVEFDGAQSALVNVVGGPDMSIEEAEGVVEEIYDRIDPDARIIWGASVDPEFDG
10703|gene|hma      LRSPLLDVEFDGANSALVNVVGGPDMSIEEAEGVVEEIYDRIDPDARIIWGASVNNEFEG
1352|gene|hhi       LRSPLLDVEFDGANSALVNVVGGPDMSIEEAEGVVEEIYDRIDPDARIIWGASVNNEFEG
895|gene|hut        LRSPLLDVEFDGANSALVNVVGGPDMSIEEAEGVVEEIYDRIDPDARIIWGASVNHDYDG
                    ********::..*:******.**..***********::::** ********:*:: : : 

376|gene|nrc1       EMRTMVVVTGVDSPQIYGRNEAA-----------------------------EGDGPAQE
1243|gene|hwa       TMRTMIVVTGVESPQIYGSSDTAAQSNAQGVEGMRVDTDGNGRVNAAESVETDTGSNAET
901|gene|hla        EMRTMIVVTGVESPQIYGRNGES-------------------------------------
25000|gene|hbo      TMRTMIVVTGVESPQIYGRSDGG-------------------------------------
717|gene|hvo        MMRTMIVVTGVESPQIYGRNGEA-------------------------------------
810|gene|nph        KMETMIVVTGVESPQIYGKSEVE-------------------------------------
10703|gene|hma      KMETMIVVTGVESPQIYGQSEAE-------------------------------------
1352|gene|hhi       KMETMIVVTGVESPQIYGQSEAE-------------------------------------
895|gene|hut        QMETMIVVTGVESPQIYGKSEAE-------------------------------------
                     * **:*****:****** .                                        

376|gene|nrc1       STPEPEPEPQAGSEIEDIDYVE
1243|gene|hwa       DEAETATRTEVPFPDEDADFIE
901|gene|hla        -----AEGEGETPEMEDIDYVE
25000|gene|hbo      -EGEPARQPQAPQQGQDIDYVE
717|gene|hvo        -------QAHAEERLEDIDYVE
810|gene|nph        -------RERAAAGDDDIDYVE
10703|gene|hma      ------QEKAAQQLGEDIDYVD
1352|gene|hhi       ------QEKAAQQLGEDIDYVD
895|gene|hut        ------REKAAQRMGDDIDYVE
                                   :* *:::