HOG Organism Gene ID Name Annotation
aHOG4057 nph NP0168 abc09a2 branched chain amino acid ABC transporter ATP-binding protein
aHOG4057 nph NP3430 abc08a2 branched chain amino acid ABC transporter ATP-binding protein
aHOG4057 hma Hma_10642 livG-3 branched-chain amino acid ABC transporter ATP-binding protein
MUSCLE (3.6) multiple sequence alignment


3430|gene|nph       MSSTPILETVDVRKEFGNLVAVDGISLEFYTD--ETVGIIGPNGAGKTTFINLISGVLPL
168|gene|nph        -----MLEARNLVKEFGKLRATDDVSLQFGTESGEMVFIVGPNGAGKTTLINLLTGLLEP
10642|gene|hma      -----MLEARNLQKSFGELVATDDITLEFGKEEGELVFIVGPNGAGKTTFINLLTGFLSP
                         :**: :: *.**:* *.*.::*:* .:  * * *:*********:***::*.*  

3430|gene|nph       TDGQILF-----AGD---DISDLKRYKRVRRGLVRSFQIPQIYDELTLRENIQSSILSRK
168|gene|nph        DEGSVVMHEQTDDGTVERDITEMRPDRRVKEGLVRSFQIVHLFEEMTVRENVRTAALSNH
10642|gene|hma      DEGSIVL-----DGD---EITGMSANGRVDAGIARSFQVVKVFEEMTVRENLRTVVLTEQ
                     :*.:::      *    :*: :    **  *:.****: ::::*:*:***:.:  *: :

3430|gene|nph       QENNRLFTPTDREEESLQEANELIETFNLEAHADEHTEHLPHGVRKVLDVAMSFALEPQI
168|gene|nph        DKFTKVRSLDDEHEAVEADVDALLEQFRLEDVADEVAETLPHGDRKLLDVAISFALDPNY
10642|gene|hma      GKTWSLFSMADGHEEVEAQVNELLEKFRLGDAADTVAEELPHGDRKLLDVAMSFGLDPDY
                     :   : :  *  *    :.: *:* *.*   **  :* **** **:****:**.*:*: 

3430|gene|nph       MFLDEPTSGVGSKEKNDVMETITQAADEQNIGLVFIEHDMELIREYSSRTVALHEGRVLL
168|gene|nph        LLLDEPTSGVGAEEKEYVIETVVEASKEQNVSTVTIEHDMDIVRTYADRMVALVEGEVFR
10642|gene|hma      LLLDEPTSGVSTREKEYVIETIVEVGRAEGVTTVTIEHDMDIVTEYADRVVALHQGAVHG
                    ::********.: **: *:**:.:..  :.:  * *****:::  *:.* *** :* *  

3430|gene|nph       DDEPDAVFNSEEVNEFILEGGV--
168|gene|nph        EGPPTLLDTDDDLRQTLLGVSEDE
10642|gene|hma      VGPPTMLETDDELRRLLLGVGEDE
                     . *  : ..:::.  :*  .