HOG Organism Gene ID Name Annotation
aHOG4054 nph NP0174 abc09s branched-chain/neutral amino acids amide ABC transporter periplasmic substrate-binding protein 5
aHOG4054 nph NP3424 abc08s branched-chain/neutral amino acids amide ABC transporter periplasmic substrate-binding protein 4
aHOG4054 nph NP4238 branched-chain/neutral amino acids amide ABC transporter periplasmic substrate-binding protein 4
aHOG4054 hma Hma_10647 abcS-1 ABC transporter substrate-binding protein
MUSCLE (3.6) multiple sequence alignment


3424|gene|nph       -----MTDNRIRSSRRRLLKGAAAAGGIGAFAGCALL-----EEAGEEEQLDGIPDEPFR
4238|gene|nph       -----MSDNTTHASRRRFLKGAAAAGGIGAFAGCALL-----DDAGGEEQVEGIPDEPFR
174|gene|nph        ------MTDSFNLDRRNVLKAAGGTAVAAALAGCSVLL-DGEENGNGGAALEDVPDEPIE
10647|gene|hma      MQQTTTDHDTGGIGRRQLLSAVGGSAVAAALAGCSTLLSDGETADQGEQSGGEISDEPIQ
                            :    .**..*.....:.  .*:***: *                :.***: 

3424|gene|nph       IVHFTFESGPPAFYGDEMINAVDMMVDRINDRGGLLGEREIEIVDRIDEDAGVESMRGSV
4238|gene|nph       IVHFTFESGPPAFYGEPMINVVDMMVDRINDRGGLLGEREIEVVDRIDEDVGVESMRGSV
174|gene|nph        AGLQTFREGAPSVLGLQAEYGAQTAIRRINDAGGIAG-RQMELDVIEEEGATIENYRRFV
10647|gene|hma      AGLLTFTRGAPGVLGIQAQRGAELAVQRINEAGGIGGQREIELDVVNEGSNPLDSYNQFI
                        **  *.*.. *      .:  : ***: **: * *::*:    : .  ::. .  :

3424|gene|nph       RQIAQNDEADMLMGLISSANALSVVPAAEENQIPFLVTVPGTYQLFEEN-PDLEYAVRTA
4238|gene|nph       RQIAQNDEADMLMGLVSSAHSLSIAPAAEENQIPFIVTAPGTYQLFEEN-PDLDYVVRPA
174|gene|nph        -----DEGKDVTFGPISSGGHEELVPVVEEEGVVNVGTDGTVTTLYETEYPDVEYSFRFQ
10647|gene|hma      -----EEGKEVTFGPISSGTHSQIAPEIEKNGIINVSTDGTVTTLYEETVPDPTYSFRFQ
                         ::  :: :* :**.   .:.*  *:: :  : *   .  *:*   **  * .*  

3424|gene|nph       GTNAAGAIGGAR-IVEQM--DDVETVVTVDQDYAWGHDHRDMFVEALERIRPDIEVLETR
4238|gene|nph       GSNAAGAVGGAR-LVEQM--DDVETVVTIDPDYAWGHDHRDMFTAAIERIRPDIEVLETR
174|gene|nph        NHDVMEALSAARTAVEQLGAENIDTFANINPDYTFGYDEREVFNAGIEQL-TGAEEVYDG
10647|gene|hma      NYDIMEVVTMAREAVERIGADNISTVAGVNPGYSFGEDEMRVFTQAIQRL-TDAEIVYEG
                    . :   .:  **  **.:  :::.*.. :: .*::* *   :*  .::.: .. * :   

3424|gene|nph       TPEPFISDYSAHISAVQDLEPDVVFSSLWGGDISTFTSQAVDDGLFDDIGTGVFVGDTGA
4238|gene|nph       TPEPFISDYSAHVNAIQDLEPDLLASSLWGGDISTFTSQAVDGGLFDDIGTALLYGDTGA
174|gene|nph        YPELGADDMSTHVTAVADAEPDVLFTSCWGGDATLLLDQGQAGDLFDAVDITV------G
10647|gene|hma      FPELGASDMANHITSINNEEPDVTFSSLWGGDVTTFVRQANANNMFEN--TTVF-----G
                     **   .* : *:.:: : ***:  :* **** : :  *.  ..:*:     :      .

3424|gene|nph       PLLRALGDDMPENVIMG---------------GRGGYQPN---YRYETAEDHQEFVDDYF
4238|gene|nph       PLLDSLGDDMPENVIMG---------------GRGGYQPN---YRYEISSDHRAFVDDYF
174|gene|nph        PVLYSAANDFSEELVEG-NIWSGSRNFYWGSPPQNQWDPGVELFE-EAQDEHDTIPTAHF
10647|gene|hma      TTLYSAAGDVPGDALAGTDIYSGSRNYYWGKPALGNWQPGRELFDAATQQEGVTVPTAHY
                    . * : ..*.. : : *                 . ::*.   :     .:   .   ::

3424|gene|nph       DRYGDMPGWGAYHDWVAFQALEAGVEQAVQLTGNWPTGSQLMSSIRGLSFETTHGSHVMA
4238|gene|nph       DRYDEMPGWGAYHEWASFKALEAGVQQAVEVTGNWPTGSQLMNSIRGLSFEMSHGSHVMA
174|gene|nph        -----MSGYGAVTAWAT------AVEKAVDIVGGWPSQDQIAATLENHGFYTPAGYHTIG
10647|gene|hma      -----MSGYGAVTAWAT------AVEKAIDLLGTYPTQEQIAQVLEGHGFFTPAGYHNIA
                         *.*:**   *.:      .*::*::: * :*: .*:   : . .*  . * * :.

3424|gene|nph       QAGGRQASAPGVFGQPTPDHDFPVDHHLLTDYEFIPAHECNPPEGMDTFEWVEQIEPVE
4238|gene|nph       QAGGRQASAPAVFGQPTPDHDHPVDHHLLTDYEFIPAHECNPPDGVMTFDWVEQIDPVQ
174|gene|nph        P--DHQGYSTAHFGEMTWDDG--MDMPVLENVTTIPASHVSPPQGEISIDWIESW----
10647|gene|hma      E--DHQGASNSFAGQMVYDDD--LGAARLEDVNTYAATETAPPPGVTGSDWLDSWSA--
                       ..*. : .  *: . * .  :.   * :    .*    ** *    :*::.