HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0404COG1014 COG0674arCOG01606putative 2-ketoglutarate ferredoxin oxidoreductase (alpha)

HOG Organism Gene ID Name Annotation
cHOG0404 nrc1 VNG1128 korA putative 2-ketoglutarate ferredoxin oxidoreductase (alpha)
cHOG0404 hmu HMUK2160 Hmuk_2160 pyruvate flavodoxin/ferredoxin oxidoreductase domain protein( EC:1.2.7.3 )
cHOG0404 hma RRNAC1267 korA 2-oxoglutarate ferredoxin oxidoreductase subunit alpha
cHOG0404 hwa HQ3356A porA pyruvate--ferredoxin oxidoreductase, alpha subunit
cHOG0404 hla HLAC0891 Hlac_891 pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
cHOG0404 hbo HBOR19200 Hbor_19200 2-oxoacid:ferredoxin oxidoreductase, alpha subunit( EC:1.2.7.3 )
cHOG0404 hut HUTA2848 Huta_2848 pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
cHOG0404 hvo HVO_1305 HVO_1305 2-oxoglutarate ferredoxin oxidoreductase subunit alpha
cHOG0404 nph NP4046A porA pyruvate--ferredoxin oxidoreductase, alpha subunit
cHOG0404 hhi 1861 korA 2-oxoglutarate ferredoxin oxidoreductase subunit alpha
MUSCLE (3.6) multiple sequence alignment


1128|gene|nrc1      MPYWSTAGPDQIMTDDELIWRIAGGSGDGIDSTSQNFAKALMRSGLDVFTHRHYPSRIRG
4046|gene|nph       ------------MTE-ELVWRIAGGSGDGIDSTSQNFAKALMRSGLNVFTHRHYPSRIRG
891|gene|hla        ------------MTDDELIWRISGGSGDGIASTSQNFAKALMRSGLNVFTHRHYPSRIRG
3356|gene|hwa       ------------MTDDELIWRIAGGSGDGIASTSQNFAKALMRAGLHVFTHRHYPSRIRG
19200|gene|hbo      ------------MTDDELIWRIAGGSGDGIASTSQNFAKALMRSGLHVFTHRHYPSRIRG
2848|gene|hut       ------------MTDTELIWRIAGGSGDGIASTSQNFAKALMRAGLNIFTHRHYPSRIRG
11267|gene|hma      ------------MTDNELIWRIAGGSGDGIDSTSQNFAKALMWSGLNVFTHRHYPSRIRG
1861|gene|hhi       ------------MTDNELIWRIAGGSGDGIDSTSQNFAKALMWSGLNVFTHRHYPSRIRG
                                **: **:***:******* ***********.:** :************

1128|gene|nrc1      GHTYVEIRARDGTVTSRGDGYNFLLALGDSFARNPSEEAVYGDEEVKPLTENLDDLRAGG
4046|gene|nph       GHTYVEIRAAPEPVSSRGDGYNFLLALGDSFARNPQEEAYYGDEEVKPLEENLDDLREGG
891|gene|hla        GHTYTEIRASSDPVKSRGDGYNFLLALGDSFARNPQEEAIYGNEEIKPLSENLDELREGG
3356|gene|hwa       GHTYTEVRVSADSVTSRGDGYNFLLALGDSFARNPQEDAYYGVEEIKPLSENLDDLDEGG
19200|gene|hbo      GHTYTEIRASADPVKSRGDGYNFLLALGDSFARNPQENAYYGNEEIKPLSENLDELREGG
2848|gene|hut       GHTYVEVRAKDEEVTSRGDGYNFLLSLGDSFARNPAEDAYYGNEERKPLGENLDELREGG
11267|gene|hma      GHTYVEVRAKDEPVQSRGDGYNFLLALGDSFARNPQEEAYYGKEELKPLYENFDDLREGG
1861|gene|hhi       GHTYVEVRAKDEPVQSRGDGYNFLLALGDSFARNPQEEAYYGKEELKPLYENFDDLREGG
                    ****.*:*.    * **********:********* *:* ** ** *** **:*:*  **

1128|gene|nrc1      VIIYDEGLLDDEDVGD--LEQQADANDWHLYPLDLRGLAKEHGREVMRNTAGVGATAALI
4046|gene|nph       IIVYDEGLVDIDDIED--FEARVEANDWHVYPLDLRGLARDVGREVMRNTAGVGATAALL
891|gene|hla        VIVYDEGLLDASEIPD--FEERVEENNWHVYSLDLRGLARDQGREVMRNTAGVGATCAIT
3356|gene|hwa       VIVYDTGLLDPDDIPN--FDERIDANNWHVYDINLREIAREHGREVMRNTAGVAITCAIA
19200|gene|hbo      VIIYDSGLLDASEIED--FDERVEENNWHVYDLDLRTMARDHGREVMRNTAGVGATCALA
2848|gene|hut       VIVYDTGLFDEDEVAELNLEERAEENNWHVYPVNLREIAREHGRDVMRNTAGVGITAALL
11267|gene|hma      VLLYDEGLLDDEDVDEIGLEEAAEENNWHVVPMDLRGIAKEHGREIMRNTAGIGATAAIL
1861|gene|hhi       VLLYDEGLLDEEDVDEIGLEEAAEENNWHVVPMDLRGIAKEHGREIMRNTAGIGATAAIL
                    :::** **.* .:: :  ::   : *:**:  ::** :*.: **::******:. *.*: 

1128|gene|nrc1      DMDLDHIEDLMSDAMGGDILEQNLTVLRDAYEQV-SEMEHT-HDLSVPTGSHDEPQVLMS
4046|gene|nph       EYDLEHVEDLMADAMSGEVLETNLDILETAYEEV-AEMEHT-HDLRIPTGSHDEQQVLLS
891|gene|hla        GMDLDHVQDLMRDAMPEKILEPNLEILQIAYDQVREEYDVDASDVSVPTGEHDETQLLMS
3356|gene|hwa       DIDPGIIKDMMADAMPDKIFEPNMDVFDDAYETVTSEFDATAPDISVPTGNHDEEQVLVS
19200|gene|hbo      GIDTEWIEELMRDAMPEKILEPNLEILQEAYEMVEEEYDVDAHDVKIPEGEHEEEQVLLS
2848|gene|hut       GMDVSYFEELITQNMSGDIQEDNLNVLADAYEQA-QAFEFT-HDLEVPTGENDQELALMN
11267|gene|hma      DISTDEFEKLITQNMSGDMQEANLNVLHDAYEAA-SELDVD-HDIEVPEGSHDEEQVILS
1861|gene|hhi       DISTDEFEKLIKQNMSGDMQEANLNVLHDAYEAA-SELDID-HDIEVPEGSHDEEQVILS
                      .   .:.:: : *  .: * *: ::  **: .    :    *: :* *.:::   ::.

1128|gene|nrc1      GSHAIAYGAIDAGCRFISGYPMTPWTDAFTIMTQLLPDMGGVSEQVEDEIAAAAMAVGAS
4046|gene|nph       GSNAITYGALDAGCRFIAGYPMTPWTEVFTLMSQHLPEVGGISEQVEDEIAAAALALGAS
891|gene|hla        GSDAISYGAIDEGCRFIAGYPMTPWTEVFTIMTKNLPKLGGISEQVEDEIAAAALAVGAS
3356|gene|hwa       GSDAIAYGAIDEGCRFISGYPMTPWTEVFTIMSQNLPEIGGVSEQVEDEIAAAALAIGAS
19200|gene|hbo      GSDAIAYGALDEGCRFIAGYPMTPWTEVFTIMSQNLPELGGISEQVEDEIAAAALAIGAS
2848|gene|hut       GSQSIAYGAIDEGCRFIAGYPMTPWTEVFTIMSQHMGKFGGVSEQVEDEIAAAAMALGAS
11267|gene|hma      GSNAISYGAIDEGCRFISGYPMTPWTDVFTIMSQHLPEFGGISEQVEDEIAAAALALGAS
1861|gene|hhi       GSNAISYGAIDEGCRFISGYPMTPWTDVFTIMSQHLPSFGGISEQVEDEIAAAALALGAS
                    ** :*:***:* *****:********:.**:*:: : ..**:************:*:***

1128|gene|nrc1      HAGAKAMSGSSGGGFALMSEPLGLAEMTETPLVLLEAQRAGPSTGMPTKPEQADLEHVLY
4046|gene|nph       HAGVKAMSGSSGGGFALMSEPLGLAEMTETPLVLVEATRAGPSTGMPTKPEQSDLEHVLY
891|gene|hla        HAGVKAMSGSSGGGFALMSEPLGLAEMTETPVVLVEAMRAGPSTGMPTKPEQSDLEHVLY
3356|gene|hwa       HAGVKAMSGSSGGGFALMSEPLGLAEMTETPVVLIEAMRAGPSTGMPTKPEQGDLEHVLY
19200|gene|hbo      HAGVKAMSGSSGGGFALMSEPLGLAEMTETPVVLVEAMRAGPSTGMPTKPEQGDLEHVLY
2848|gene|hut       HAGVKAMSGSSGGGFALMSEPLGLAEMTETPIVLLEAMRAGPSTGMPTKPEQGDLEHVLY
11267|gene|hma      HAGVKAMSGSSGGGFALMSEPLGLAEMTETPIVLVEAMRAGPSTGMPTKPEQADLEHVLY
1861|gene|hhi       HAGVKAMSGSSGGGFALMSEPLGLAEMTETPIVLVEAMRAGPSTGMPTKPEQADLEHVLY
                    ***.***************************:**:** **************.*******

1128|gene|nrc1      TSQGDSHRVAFGPKDPKECYEQTRTAFEIAYDYQIPVILLYDQKLSGEYRNVDASFFDRE
4046|gene|nph       TSQGDSCRVVFAPGNVREAYEQTRAAFELAYEYHLPAIVLYDQKLSGELRNVDESFFDRE
891|gene|hla        TSQGDSQRVVLAPGTVEEAYEQSRIAFRLAYEYQIPSILLYDQKLGGELVNVPKSHFDRE
3356|gene|hwa       TSQGDSHRVVFAPADSEEAYHQTRRAFEIAYEYQIPSIILYDQKNGGELQNIPATVFDEE
19200|gene|hbo      TSQGDSHRVVFAPSGAEEAYHQTRRAFQIAYEYQIPSIVLYDQKNGGELQNVPASVFDEE
2848|gene|hut       TSQGDSARVVFAPAGVKEAYEQTRTAFEIAYDYQIPAIVVYDQKIEGELRSVPVDLFDRE
11267|gene|hma      TSQGDSARVVFAPANIRECYTQTRSAFRIAYEYQIPVIVIYDQKIQGELRNLPASHFDEE
1861|gene|hhi       TSQGDSARVVFAPANIRECYTQTRSAFRIAYEYQIPAIVIYDQKIQGELRNLPASHFDEE
                    ****** **.:.*    *.* *:* ** :**:*::* *::****  **  .:    ** *

1128|gene|nrc1      PAADLGTTLSEDQIPDAPHDPTGKYHRYQHDVEDG--VSPRTIPGQSGGRYLASGNEHWP
4046|gene|nph       PDADLGATLTEAEIAEAAHHASGKFNRFQHDPDNDRGVSPRSLPGQTGGRFLATGNEHTE
891|gene|hla        PNPTLGKTLSEDALADEPHSADGKFHRFQHDVEDG--VSPRSIPGQKGGRYLATGNEHDP
3356|gene|hwa       PNPDLGSTLTEAELEDASHDPSGKYNRFQHAGENG--VSPRSLPGQEGGRFLATGNEHMP
19200|gene|hbo      PNGDLGSVMTEEELADAPHDDSGKYNRFQHEGENG--VSPRSIPGQKGGRYLAAGNEHMP
2848|gene|hut       PNPDLGKVLSEEEIKEAAHHESGAFQRFDPNAEDG--VSPRTVPGQKGGRHLTSGNETND
11267|gene|hma      PNADPGSVLTEEEIQDAAHHSSGKFQRFLHEPEDGSNVSPRSVPGQKDGRFLATGNEHNP
1861|gene|hhi       PNADPGSVLTEEEIQDAAHHSSGKFQRFLHEPEDGSNVSPRSVPGQKDGRFLATGNEHNP
                    *    * .::*  : : .*   * ::*:    ::.  ****::*** .**.*::***   

1128|gene|nrc1      NGHISEDTDNRVAQVERRLQKLAAIRDDLD--ERDQQTHYGDEDADIGLIAWGSQEGTVE
4046|gene|nph       QGHISESPENRVAQLERRLGKLDAIREELDAADSSHQTYYGPDEAEYGLITFGSQQGTVR
891|gene|hla        TGHICEDADNRVAQIDRRTQKLEAIRADLDTEDTG--SYAGPDDAQYGILTFGSQQGTVE
3356|gene|hwa       AGHISEDPDNRVNQVNRRMEKLEAIRDDLETDGQTRNTQYGPSEAQYGILTFGSQQGTVR
19200|gene|hbo      AGHISEDPENRVLQVNRRMEKLEAIRADLDSDETSNNTLYGPEDAEYGIMTFGSQQGTVE
2848|gene|hut       YGHIDEDPDNRVAHMSRRLEKLDTIRGDLD-EGETNQAYRGPEDARYGIVTWGSQQGTVF
11267|gene|hma      SGHISEDPENRIAQMNRRLNKLDDIRADLD-ENTSHQTYHGPEEADYGILVWGSQQGTVF
1861|gene|hhi       SGHISEDPENRIAQMNRRLNKLDDIRADLD-ENTSHQTYHGPDEADYGILVWGSQQGTVF
                     *** *..:**: ::.**  **  ** :*:       :  * .:*  *::.:***:*** 

1128|gene|nrc1      EAVHRLNDDGNSVKALGISDLAPFPVAETRAFVDSVDEAIVVEMSSTKQFRGLIQKEVGD
4046|gene|nph       EAVTRLNDAGHSVRAVSISDLMPFPEAEIETFIESVEEAVVVEMTASAQLRGLIQKELGR
891|gene|hla        EAVGRLNDDGISVKSYGVSDMLPFPTEQVEAFVESVDEVLVVEMTASGQFRGLIQKNLGR
3356|gene|hwa       EAIDELDTEGYHVKMLGVSELAPYPVKEVSSFIESVDEVLVVEMNASAQFRGLTQKELGR
19200|gene|hbo      EAIDRLNDRGYSVKALGVSEMAPYPVEQVSEFLESVEDCLVVEMNASAQFRGLTQKEVGR
2848|gene|hut       EAVDRLNDEGHSVKAIGVSDLMPYPEAEMTEFLESVEEAIVVEMNASGQFKGLTQKELGR
11267|gene|hma      EAVDRLNENGHSVKALGVSDMAPYPKEEVSEWLESVDEALVVEMNATAQFRGLTQKELGK
1861|gene|hhi       EAVDRLNENGHSVKALGVSDMAPYPKEEVSEWLESVDEALVVEMNATAQFRGLTQKELGK
                    **:  *:  *  *.  .:*:: *:*  :   :::**:: :****.:: *:.** **::* 

1128|gene|nrc1      IGGKLSSLLKYNGNPFEPAEIVEAVEIEQ-AGDGAEPAAQTTLEPAAGD
4046|gene|nph       FGPKLHSLLKYNGNPFEPQEVVDGFESAIEDED---PAPTTRFVPAAGD
891|gene|hla        YGEKLSSLLKYNGNPFEPAEIVDGFEAAIIEGDGDASGHQTTFVPAAGD
3356|gene|hwa       YGDKLSSLLKYNGNPFEPAEIVDGFINSIVEDR-TLNGNETKYIPAASD
19200|gene|hbo      FGEKLSSLLKYNGNPFEPEEITEGFITSIVEGE-ELPTHETKFVPAASD
2848|gene|hut       FGDKLSSLLKYNGNPFEPAEIVEGFEASI-DEETDLPGNSTTFVPAAGD
11267|gene|hma      YGDKLSSLLKYNGNPFEPAEIVDGFESSI-DGE-ELAASNMKYVPAAGD
1861|gene|hhi       YGDKMSSLLKYNGNPFEPAEIVDGFESSI-DGE-ELAASNMKYVPAAGD
                     * *: ************ *:.:..                   ***.*