HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0403COG1382KOG3478 KOG1760arCOG01342Prefoldin chaperonin cofactorprefoldin homolog

HOG Organism Gene ID Name Annotation
cHOG0403 nrc1 VNG0234 vng234 prefoldin homolog
cHOG0403 hmu HMUK0008 Hmuk_0008 prefoldin, beta subunit
cHOG0403 hma RRNAC1680 pfdB prefoldin beta subunit
cHOG0403 hwa HQ1286A pfdB prefoldin beta subunit
cHOG0403 hla HLAC0567 Hlac_567 prefoldin, beta subunit
cHOG0403 hbo HBOR25580 Hbor_25580 prefoldin, beta subunit, archaeal
cHOG0403 hut HUTA2676 Huta_2676 prefoldin, beta subunit
cHOG0403 hvo HVO_0651 HVO_0651 prefoldin beta subunit
cHOG0403 nph NP0612A pfdB prefoldin beta subunit
cHOG0403 hhi 2216 pfdB prefoldin beta subunit
MUSCLE (3.6) multiple sequence alignment


612|gene|nph        -------------MQGNLPPEAQEKIEELQDLQETAQQVAQQKQQAETQLRESETALETL
567|gene|hla        -------------MQGNMPPEAQEKIEELQELQETAQQVAEQKEQAQSALNESKTALDAL
1286|gene|hwa       -------------MQGNLPPEAQEKLEELQDLQETAQKVAAQKDQAESTLNESEAALDAL
25580|gene|hbo      ---------MELSMQGNLPPEAQEKLEELQDLQETAQKVAAQKQQAESTLTESETALDAL
234|chp|nrc1        -------------MQGNLPPEAQEKLEQLQDLQEKAQNVATQKQQAEQQLSEAETALDAL
2676|gene|hut       -------------MQGNLPPEAQEKLEELQDLQETAQQVAQQKQQAQTQLTESENALEAL
11680|gene|hma      MHGFNTPAPNSGGMQGNLPPEAQEKLEELQDLQQTAQQVAAQKQQAETELQESQTALDEL
2216|gene|hhi       -------------MQGNLPPEAQEKLEELQDLQQTAQQVAAQKQQAETELQESQTALDEL
                                 ****:*******:*:**:**:.**:** **:**:  * *:: **: *

612|gene|nph        DDIEGDTQMYQEVGELLIETDYDEAYENLEEKVDSLEVRVETLTKQEERVQDQFEGLQEE
567|gene|hla        EDVDEDAGMYREIGEVLVETDYESAYDDLENKVDSLEVRTEQLEKQEERVQEQFDDLQGE
1286|gene|hwa       EDVNEETMMYREVGELLVETEYDTAHDELSDKVDSLEIRVEQLQKQEDRVRDQFESLQEE
25580|gene|hbo      EDIDEDTVMYREVGELLVETDYETAHEDLTDKVDSLEVRVEQLKKQEERVQEQFESLQSE
234|chp|nrc1        GDIEESTTMYREVGELLVETEYDNAHDDLDEKVSDLEVRVETLQKQEDRVQEQFESLQEE
2676|gene|hut       EDIDPDSTMYREVGELLVETEYDEAEDDLSETVDNLEVRVDSLEKQEERVEEQFEELQGE
11680|gene|hma      DDIDEDSTMYREVGELLVKTEFDEAQDDLEEKVNSLEVRVETLEKQEERVQEQFEELQSE
2216|gene|hhi       DDIDEDSTMYREVGELLVKTEFDEAQDDLEEKVNSLEVRVETLEKQEERVQEQFEELQSE
                     *:: .: **.*:**:*::*::: * ::* :.*..**:*.: * ***:** :**: ** *

612|gene|nph        LQEMLQGGAGGGPMGP-GGPGAGGA
567|gene|hla        LQQMLQGGAGGGPMGP-GGPGAGGA
1286|gene|hwa       LQQMLQGGAGGG--GP-MGPGGAGA
25580|gene|hbo      LQQMLQGGAGGGPMGP-G--GAGGA
234|chp|nrc1        LQDMLGGAGGAMGGGP-------GA
2676|gene|hut       LQEMLGGGGGALGGGPDVGPGAGGA
11680|gene|hma      LQQMLGGAGGA---GPAGGPGAGGA
2216|gene|hhi       LQQMLGGAGGA---GPAGGPGAGGA
                    **:** *..*.   **       **