HOG Organism Gene ID Name Annotation
aHOG4026 hla HLAC2114 Hlac_2114 hypothetical protein
aHOG4026 hmu HMUK2288 Hmuk_2288 hypothetical protein
>2114|hp|hla !!AA_SEQUENCE 1.0
MTAGDRIEREIEESSDARPTVAASRCSPDRTVFTEEGNTDAWIATDLTVELER