HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0401COG3273arCOG01963Uncharacterized conserved proteinpotassium channel homolog

HOG Organism Gene ID Name Annotation
cHOG0401 nrc1 VNG2104 pchB potassium channel homolog
cHOG0401 hmu HMUK0838 Hmuk_0838 TrkA-C domain protein
cHOG0401 hma RRNAC2512 pchB potassium channel-related protein
cHOG0401 hwa HQ1350A pchB potassium channel protein
cHOG0401 hla HLAC1691 Hlac_1691 TrkA-C domain protein
cHOG0401 hbo HBOR26880 Hbor_26880 uncharacterized conserved protein
cHOG0401 hut HUTA1522 Huta_1522 TrkA-C domain protein
cHOG0401 hvo HVO_0467 HVO_0467 pchB potassium channel homolog
cHOG0401 nph NP0220A hypothetical protein
cHOG0401 hhi 2942 pchB potassium channel-like protein
cHOG0401 hhi 928 HAH_0928 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


928|hp|hhi          -----MAVGTVVRLDVYYSDCATCQCMSDDDDLEAEVRDLRAEVDALQTRITALESKLDT
2104|gene|nrc1      -----------MGGRVEYEPAS--------------AKDLLVELKDTAELLVDLSFSAVL
1522|gene|hut       ---------MASGEDVTYEPVS--------------VKDVLAEMKDTAELLIDLSYSAVL
12512|gene|hma      ---------MDPTGTVEYEPVS--------------VKQVLAEMKDTAELLIDLSYSAVL
2942|gene|hhi       MLGAIESTAMDPTGTVEYEPVS--------------VKQVLAEMKDTAELLIDLSYSAVL
1350|gene|hwa       -----------MDRDVEYEPVN--------------VKTILAEMKDTAELLIDLSYSAVL
26880|hp|hbo        ----------MKPEDVEYEPVS--------------VKDVLAEMKDTAELLIDLSFSAVL
1691|gene|hla       ---MGRFDGRDGPLRVRYEPTS--------------VKDLLVEMKDTAELLIDLSYSAVL
220|hp|nph          ---MTGFDEGAQPRTVDYEPRS--------------VKDLLVEMKDTSELLIDLAYSAVL
                                   * *.                 .. : .*:.     :  *  .   

928|hp|hhi          DPPPSVGDETATTEADTAAPESEATHGSETAPETGETADSDAPVDERNWERDIGMKWLGG
2104|gene|nrc1      HGSDNVADEVLRLEKRMDVLQLRARMTLLLAARSPADAESLAPV--------LGV--VAA
1522|gene|hut       LGSDEIAEEVLALEERMDVLHLRARMSLLMAARNPEDAEALAPV--------LGV--VGA
12512|gene|hma      LGSDDVAAEVLELEEKMDVLQLRARMSLLMACRSTADAESLAPV--------LGM--VGA
2942|gene|hhi       LGSDDVAAEVLELEEKMDVLQLRARMSLLMACRSTADAESLAPV--------LGM--VGA
1350|gene|hwa       HESDEIADEVLDLEARMDRLQLQGRMSLLMAARRPEDAEQLAPV--------LGV--MAA
26880|hp|hbo        NESDDIAREVLELEERMDVLKLQGRMSLLMAARSTEDAEQLSSV--------LGV--VGA
1691|gene|hla       HGSPTIAHEVVELEHRMDVLQMRARMSLMLAARSPDEAETLAPV--------LGV--VGA
220|hp|nph          HQNDELASEVLALEEKMDVLQMRARMSLMLAVRNPKEAEALAPV--------LGI--VAG
                         :. *.   *         .      *      *:  :.*        :*:  :..

928|hp|hhi          VGGLALVVGVVFFIRLAIEAGYLGPLGRVLTGTAGGLI---LLAGGRYAAERQGYDRWGR
2104|gene|nrc1      TEKMSDAAGDIAKVVRE-DVGLPDAMQGALPDAAESLVRGRLVADSRYA---------DR
1522|gene|hut       AEKISDAAGDIAKVVLE-DIGLPAAMRATLPEAVETLVRATVAADSTYA---------DR
12512|gene|hma      AEKISDAAGDIAKIVLE-DIGLPDTMRAALPEAVETLVRATISSESALA---------GE
2942|gene|hhi       AEKISDAAGDIAKIVLE-DIGLPDTMRAALPEAVETLVRATIGSDSRLA---------NE
1350|gene|hwa       AEKISNAAGDIAKVVVE-DIGLPNAIRGSLPGAVEVLIRATVESGSRYA---------DH
26880|hp|hbo        AEKIANAAGDIAKVVME-DIGLPDAIRSALPEAAEMLVRATAAADSDYT---------GR
1691|gene|hla       ADKISDAAGDIAKIVTE-EIGLPDAMRGALTEGVETLVRGTVSADSAYA---------GR
220|hp|nph          ADHVSDAAADIAKIVLD-DIGLPESMRAALPEAVETLVRGTVAPASSYT---------GR
                    .  :: ... :  :    : *   .:   *.  .  *:     . .  :         . 

928|hp|hhi          LVAGTGLAIAYFSVYAAYGFESYRAAIGAPLWAVLLVLTALVAATAVLSVRDHAPAVAGE
2104|gene|nrc1      TLGDVDLETN--------------------------------TGVRVIAVRRGD-GDAGD
1522|gene|hut       TLGGLNLETA--------------------------------TGVRIIAIRRSG-----E
12512|gene|hma      TLGGLNLETE--------------------------------TGVRALAIRRQG-----N
2942|gene|hhi       TLGSLNLETE--------------------------------TGVRALAIRRQG-----N
1350|gene|hwa       TLAEINMETE--------------------------------SGVRVIAIRRNAVTGKQQ
26880|hp|hbo        SLADINMETE--------------------------------TGVRVIAIRRQSVTGKRR
1691|gene|hla       TLKDIDLESK--------------------------------TGVRVIAIRRED-----D
220|hp|nph          TLEGINLESE--------------------------------TGVRVIGIRRGD-----E
                     :   .:                                   :..  :.:*         

928|hp|hhi          AFLLGYVTAYVGLDAASFVVSPAYVVLLTAGLVTIAAVRPWSRLVLGSVLPAYVLHIAWM
2104|gene|nrc1      ----------------------------------------------------------WL
1522|gene|hut       ----------------------------------------------------------WL
12512|gene|hma      ----------------------------------------------------------WL
2942|gene|hhi       ----------------------------------------------------------WL
1350|gene|hwa       ----------------------------------------------------------WL
26880|hp|hbo        ----------------------------------------------------------WI
1691|gene|hla       ----------------------------------------------------------WI
220|hp|nph          ----------------------------------------------------------WI
                                                                              *:

928|hp|hhi          NRLEPPEAVATAVLVATFAVYAAGVYVLRASDRTDRWHRRLVEATTGLNAVFAAILLEGV
2104|gene|nrc1      PNPGPET-----------TLRPADVLLLRGP-------------TTGVEGVYETVTGTAY
1522|gene|hut       MNPDAET-----------TLRSGDVLLARGP-------------EEGIAEVYAATTGGTY
12512|gene|hma      LNPERET-----------RLEAGDVVLFRGP-------------EDGIAEVYQDATGEVY
2942|gene|hhi       LNPDRET-----------RLEADDVVLFRGP-------------EAGIAEVYQDATGDVY
1350|gene|hwa       INPGADT-----------HLYEGDSILLRGP-------------QDGVATVYAAATGESY
26880|hp|hbo        LNPNRET-----------TLQENDVLLLRGP-------------QAGIQTVFETVTTSPY
1691|gene|hla       FNPGPKT-----------QIEVGDVTLLRGP-------------ETGVVDVHPTLTGDPF
220|hp|nph          LNPGPET-----------KLAAEDTVFLRGP-------------EQRLDEVYMTLTGTEY
                     .                 :   .  . *..                :  *.        

928|hp|hhi          VRRLIPTAPDGVAVGAVGLALGGVYAVTESRLGQQDSAAGVLAVVLLAISVVLGADPFLA
2104|gene|nrc1      D----PPAPSEPAVADLGRAVTSVALMKN---------MSELAVDLAYGAVLFDDDGLAE
1522|gene|hut       E----PPAPPESDIEDLERAVDSIVLMKN---------MSELAVDLAYGAVLFDSEAVAE
12512|gene|hma      E----PPEPPEGGVRDLERAVDSIVLMKD---------MGELAVDLAYGAVLFDSTEVAE
2942|gene|hhi       E----PPEPPEGGVRDLERAVDSIVLMKD---------MGELAVDLAYGAVLFDSTEVAE
1350|gene|hwa       E----PPVVTKEPIDDLERAVNSITLMKD---------MSELAVDLAYGAVLFESTGVAE
26880|hp|hbo        E----PPEIRESPIEDLERAVDSIILMKD---------MSELAVDLAYGSVLFDSEDVAE
1691|gene|hla       D----PNEPPEPAINDLERAVDSIVLMKN---------LSELAVDLAYGSVLFDNEALAE
220|hp|nph          E----STEPPEPDIDDLERAVDSIILMKN---------LSELAVDLAYGSVLFDSDELAA
                         .       :  :  *: .:  :.:          . *** *   :*::    .  

928|hp|hhi          TAGLLLLLCGALALGFRRDARAVRIGGHLVAVGTVAKLLAVD-ATELPAFSLADPLATAM
2104|gene|nrc1      EVVELEAEVDALKSRF--EAWTLRAATDIADPVSLRGLMQIATATEVIS-------DAAV
1522|gene|hut       EVLELEAEVDALQSRF--EAWTLQAAGRVDDPIALRGLVHLARSTEVIS-------DAAL
12512|gene|hma      EVVELEAEVDALQSRF--EAWTLRAAADIDDPVSLRGLVHLARSTEVIS-------DAAL
2942|gene|hhi       EVVELEAEVDALQSRF--EAWTLRAAADIDDPVSLRGLVHLARSTEVIS-------DAAL
1350|gene|hwa       EVKELEAEVDALKSRF--EAWTLRAATRLADPVRLRGLVHIASATEVIS-------DAAL
26880|hp|hbo        EVKELEAEVDALKSRF--EAWVLRAAGRVDDPVQLRGLVHIASATEVIS-------DAAL
1691|gene|hla       EVSNLEIEVDALQSRF--EAWTLRAAQEADDPVSLRGLIHLGVATEEIS-------DAAL
220|hp|nph          EVRNLEVEVDALRSRF--EAWLLGAAADADDPVALRGLIYLGVSTETIS-------DAAL
                     .  *    .**   *  :*. :  .        :  *: :  :**  :        :*:

928|hp|hhi          GRPAAYLLGIAVFYALGRWFGGASTTVPSTDRELSVAAPYVWTATGLAVVLLGLELSGA-
2104|gene|nrc1      EISEGVLRGLDTHIVV-------QEAVEASD-EVVVRVP----------VGAGGELPGTT
1522|gene|hut       EISEGVLRGLGTHPVV-------EAAIEASD-EVIVRET----------VADGSDLDGAT
12512|gene|hma      EMSEGVLRGLSTHPVV-------TEAVQESD-EVIVRTT----------VYPDSDLAGTT
2942|gene|hhi       EMSEGVLRGLSTHPVV-------AEAVQESD-EVIVRTA----------VYPDSDLAGTT
1350|gene|hwa       EISEGVLRGIDAHPVV-------AAAVEESD-EVIVRLS----------VGVESQLSGRT
26880|hp|hbo        EISEGVLRGIDAHPVV-------AAAVEESD-EIIVRLH----------VGPGCSLANET
1691|gene|hla       EITEGVMRDIGVHPVV-------EMAVQESD-EIITRTV----------IVEGSNLDGTR
220|hp|nph          DISEGVLRGLTVHPVV-------ELAVQESD-ELLVRVA----------VEEGSDLDGTD
                      . . : .: .. .:         ::  :* *: .             :    .* .  

928|hp|hhi          -GLSVAWAVLGLAFVGV--GLALDDRSRRLQGVVVLGLVTTKVFLYDTQGLDTLARTLSF
2104|gene|nrc1      LGDQRVKTRTGMRIIAVRRGATPDTGDVAAAGSRDGHRSPEDAWVIE-PGPETTVRAGDV
1522|gene|hut       LGDLEVKTRTGMRVIAVRRPATHPTGKHSTD------------WELS-PGPATTIDAGDV
12512|gene|hma      IGDAEVKTATGMRIIAIRRGAGESERTGREGGD----------WVVS-PGPETQIQTGDV
2942|gene|hhi       IGDAAVKTATGMRIIAIRRGAGESERTGREGGD----------WVVS-PGPETQIQTGDV
1350|gene|hwa       LGAEQVKTETGMRVIAVRRG--NDDGG----------------WVVQ-PGPKTELRAGDT
26880|hp|hbo        LGDRMVKTETGMRVIAVRRADGRE-------------------WVVQ-PGPTTELKPDDV
1691|gene|hla       IENGIPATDISTSVIAIRR---PDEG-----------------WLVG-HDIDTTLRAGDA
220|hp|nph          IEAGVPVTELGMNVIAVRR---PDEG-----------------WLLV-SDIDLTLQPGDV
                           :  .  .:.:                          :     .      . . 

928|hp|hhi          LVLGGILLVASYAYARWQGEEPLKRLAG-------
2104|gene|nrc1      LLAKGTR----------SGAQKLRELAGA------
1522|gene|hut       VIAKGTR----------SGAERLGELAGSE-----
12512|gene|hma      LIAKGTR----------TGGDRLTDLTKSA-----
2942|gene|hhi       LIAKGTR----------TGGGRLTELAEGK-----
1350|gene|hwa       IIAKGTR----------AGAQLLGDAVDDPQSFEV
26880|hp|hbo        IIAKGTR----------AGAERLGELLNDPQTFDE
1691|gene|hla       VLSKGTR----------TSAEEFEALAA-------
220|hp|nph          LIAKGTR----------TSAAEFRELAVA------
                    ::  *             .   :