HOG Organism Gene ID Name Annotation
aHOG4008 hbo HBOR13840 Hbor_13840 hypothetical protein
aHOG4008 hla HLAC2075 Hlac_2075 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


13840|hp|hbo      -----------------------------------MHSPAGTT-TVEPSGARLLMMRIVG
2075|hp|hla       MFPAPLRLFFVAVPLLVAAGALAMAAFPRRMTQWQMRGPDGATRRIEPSGTRLLMMRVMG
                                                     *..* *:*  :****:******::*

13840|hp|hbo      AVIAIIALLMAFGGPMVFFYI
2075|hp|hla       VVVAGLALLMLFASFAILP--
                  .*:* :**** *..  ::