HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0400arCOG04546hypothetical protein

HOG Organism Gene ID Name Annotation
nucHOG0400 nrc1 VNG1360 vng1360 no entry
nucHOG0400 hmu HMUK2781 Hmuk_2781 GCN5-related N-acetyltransferase
nucHOG0400 hma RRNAC0034 hypothetical protein
nucHOG0400 hwa HQ2417A hypothetical protein
nucHOG0400 hla HLAC1952 Hlac_1952 GCN5-related N-acetyltransferase
nucHOG0400 hbo HBOR13860 Hbor_13860 hypothetical protein
nucHOG0400 hut HUTA2511 Huta_2511 GCN5-related N-acetyltransferase
nucHOG0400 hvo HVO_2874 HVO_2874 conserved hypothetical protein
nucHOG0400 nph NP3788A hypothetical protein
nucHOG0400 hhi 794 HAH_0794 sulfur carrier protein ThiS
MUSCLE (3.6) multiple sequence alignment


1360|hp|nrc1       -------MSNTGKAVAYEGAPLAKRG----------------------------------
1952|gene|hla      MEYALVGGPDSGTTLRLDYRAFAYAGKFVVGAPGKAVLRTSDGSPAVPEWEP--------
2511|gene|hut      MEYSIRGWPADGPTLNLDHERFAYAGKFVISTTGKAVVR---------------------
2417|hp|hwa        MEFTVLGWPPEAPTLRLDYRSFAYAGKFVLSSVGKAVLRTEDSSEIFTSPEAHAHVDANE
10034|hp|hma       MEFTLLGWPEDGHRLRLDYKQFAYAGKFVMTSTGKAVIG---------------------
794|gene|hhi       MEFTLLGWPEDGHRLRLDHEQFAYAGKFVMTSTGKAVVG---------------------
13860|hp|hbo       MQFVVLGWPDDGPTLRLDYRRFAYAGKFVMSSTGKAVVV---------------------
3788|hp|nph        MEPELLGWPPDGPTLRLDYRQFSYAGKFVMSSTGKAVVR---------------------
                           .  .  :  :   ::  *                                  

1360|hp|nrc1       ---------DDWPPDARAADDPVDDVVGAVSFNEDRTDAHAAWLRYVTVRGDRRGAGIGA
1952|gene|hla      ---------DEPLPPTVEASEFDDDVVAAISFSSDRTDPDCCRLRYVTVHVARRAEGLGP
2511|gene|hut      ---------------------ADDAIVAAAAFDTDRTDEDCLRLRYVTVREDRRGEGIGS
2417|hp|hwa        SDRGQSMHADANTNHPTESDPYDHSVLAALSFSADRTDDTTLCYRYVSVRSDKRGSGLGP
10034|hp|hma       ----------------------DDGVVAAAAFDADRTDPDTLCVRYITVRQDRQGDRLGA
794|gene|hhi       ----------------------DDGVVAAAAFDADRTDPDTLCVRYITVRQDRQGDRLGA
13860|hp|hbo       ---------DRWDTRSVPSSEYDRGVVAATAFNADRTDASTLWIRYVTVRGDRKGETLGP
3788|hp|nph        ---------D--PSGADTERDFDDDIVAAVAFNADRTAPETLWLRYVTVRADRRGEGLGP
                                            ::.* :*. ***       **::*.  ...  :*.

1360|hp|nrc1       RLCAFAAAHLLGD-HECVRIAVNNPFAYEALHKAGFGFTGQETGIAELVLERPCE-----
1952|gene|hla      RLIDRTVARLAADGYDRVKIAVNNSFAYAALYKCGFAYTGENTGIAELVLERSAGEPAAG
2511|gene|hut      RLLRFVVERARERGYDEVKAGVNNPVAYEAFYKGGLAYTGEQTGLAELVCSTTAE-----
2417|hp|hwa        RLAASLTPHAVDRGYDRLRIAVNNPFAYEAMYRAGFAWTGRETGIAELVLERPAEIPAT-
10034|hp|hma       RLLRFVRERATERGFEHVSIGVNNPFSYQAAYRAGFCFSGAESGMAELDLVWPGD-----
794|gene|hhi       RLLRFVRDRATERGFERVSIGVNNPFSYQAAYRAGFCFSGAESGMAELDLVWPGD-----
13860|hp|hbo       QLCAFVADAAQGEGYETVKIAVNNPFAYEALHKAGFSWTGETTGIAELVLERPADTHAV-
3788|hp|nph        RLCRFVVARAERRGYATAKIAVNNPFAYEALYRAGFAYTGETTGIAELILERPTDAPAP-
                   .*            .     .***..:* * :. *: ::*  :*:***    .       

1360|hp|nrc1       --HRAAGYQDGLDRYR--ERDLSPEEAAFLDRTRGASPPARV----------EW------
1952|gene|hla      DDASGGRYRAGLRAFRDGDRDLDPAEREFIAARLGERGESGE------------SGERKE
2511|gene|hut      --RRPGRYRAGLEAYR--ERDLSETDQRFVDDRASGGPPSVI--------------DSPE
2417|hp|hwa        --TTYEQYQSGLTEYR--KRDYDDPESTFLANRQETDPPALH-----------TAVNSTQ
10034|hp|hma       --RSTERYQAGLDLFR--ERDLSPDEESFLAAKADADPPTVL---------NEWAEQPSA
794|gene|hhi       --RSTERYQAGLDLFR--ERDLSPEEESFLAAKADADPPSVL---------DDWAEPPSG
13860|hp|hbo       --RTREEYQAGLDRYR--DRDLDDPESAFLTGRENADPPALVVGSGSGSGSGSGSDSDSD
3788|hp|nph        -DRSKETYQRGLDRYR--ERDLEQAETAFLRRKRQATPP-----------------EPTD
                          *. **  :*  .** .  :  *:                              

1360|hp|nrc1       ------------
1952|gene|hla      ------------
2511|gene|hut      ------------
2417|hp|hwa        ------------
10034|hp|hma       ------RTD---
794|gene|hhi       ------RTTTSG
13860|hp|hbo       FVGVMSNADTGR
3788|hp|nph        ------------