HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0040COG0644KOG2415arCOG00570Dehydrogenases (flavoproteins)hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0040 nrc1 VNG0439 vng439 no entry
cHOG0040 hmu HMUK3127 Hmuk_3127 geranylgeranyl reductase( EC:1.14.13.2,EC:1.5.5.1 )
cHOG0040 hma RRNAC0657 P-hydroxybenzoate hydroxylase
cHOG0040 hwa HQ1520A electron-transferring-flavoprotein dehydrogenase
cHOG0040 hwa HQ1534A electron-transferring-flavoprotein dehydrogenase
cHOG0040 hla HLAC1413 Hlac_1413 geranylgeranyl reductase
cHOG0040 hbo HBOR18390 Hbor_18390 2,3-di-O-geranylgeranylglyceryl phosphate reductase( EC:1.5.5.1,EC:1.14.13.2 )
cHOG0040 hbo HBOR23360 Hbor_23360 2,3-di-O-geranylgeranylglyceryl phosphate reductase( EC:1.5.5.1,EC:1.14.13.2 )
cHOG0040 hut HUTA2954 Huta_2954 geranylgeranyl reductase
cHOG0040 hut HUTA0881 Huta_0881 geranylgeranyl reductase
cHOG0040 hvo HVO_1396 HVO_1396 P-hydroxybenzoate hydroxylase
cHOG0040 nph NP4168A electron-transferring-flavoprotein dehydrogenase 1
cHOG0040 nph NP4564A electron-transferring-flavoprotein dehydrogenase 2
cHOG0040 hhi 1311 HAH_1311 P-hydroxybenzoate hydroxylase/geranylgeranyl reductase
MUSCLE (3.6) multiple sequence alignment


881|gene|hut        ------MTTAE---------------YDAVVVGAGVSGCYAAATMAEEGLDVVIVERKSE
4168|gene|nph       ------MTTFE---------------YDVAIVGAGTAGCYAGATIADAGYDVVIVDRKDA
439|chp|nrc1        ------MPAHE---------------YDVVVVGAGTAGCYAAATVADAGYDVVVVERKSA
10657|gene|hma      ------MTTHQDGNADGASATARTVSLDVVVVGAGTSGCYAAATVADAGYDVVIVERKDE
1311|gene|hhi       ------MTTHQDGNAGGASATARTVSVDVVVVGAGTSGCYAAATVADAGYDVVVVERKDE
1520|gene|hwa       MRRTGMSASQE---------------HDIVIVGAGTAGCYAAATAADAGLDVIILERKTA
1413|gene|hla       ------MSIDE---------------YDVVVAGAGTAGCYAAATIANEGLDVVIVERKDA
18390|gene|hbo      -----MTTTHE---------------YDVVVVGAGTSGCYAAATIAREGLDVVIVERKTA
1534|gene|hwa       ------MSTEA---------------YDIVVVGGGTAGTFAAATAASEGLDAIILERKSA
23360|gene|hbo      ------MPAEA---------------YDMVVVGGGTAGAFAAATAASEGLDVVLLERKSE
4564|gene|nph       ------MPPES---------------YDIVVVGGGTAGCFAAATAAQNGLDVVLLERKSE
2954|gene|hut       ------MSTDA---------------YDIVVVGGGTAGAFAAASAAQQDLDVVLLERKSE
                           .                   * .:.*.*.:* :*.*: *  . *.::::**  

881|gene|hut        SEAGHIACGDALKGASNFPEAIPRSQI-EPSITNSVVDHGHFELPSEGTAVDIPVP-GEL
4168|gene|nph       EEAGHIACGDALKGADTFPEAIPKSEI-ESSFTNTDVDHGQFEIPQEDVSLDIPIP-GEL
439|chp|nrc1        SEAGHIACGDALKGADNFPDVIPKSQL-EPAFTNTGVDHGRFEIPREDTVLNIPVP-GEL
10657|gene|hma      TEAGHIACGDALKGASDFPDAIPKSQL-EPAFTNTDVDHGRFEIPQEDTVLEIPVP-GEL
1311|gene|hhi       TEAGHIACGDALKGASDFPEAIPKSQL-EPAFTNTDVDHGRFEIPQEDTVLEIPVP-GEL
1520|gene|hwa       AEAGHIACGDALKGADKFPEAIPKSQL-DSAFTNTGVDHGRFEIPQEETVLEIPVP-GEL
1413|gene|hla       EEAGHIACGDALKGADTFPEAIPKDRL-EPAFTNTGVDHGRFEIPQEDTVLEIPVP-GEL
18390|gene|hbo      DEAGHIACGDALKGADAFPDAIPKSQI-EPAFTNTGVDHGRFEIPQEDTVLDIPIP-GEL
1534|gene|hwa       DEAGHIACGDAIKGTSTFPDVIDRKYLKSESFTNQRIQRAVFENPRGGS-VDIDFA-DHG
23360|gene|hbo      EEAGHIACGDAIKGTSTFPDVIDLDYLKEESFTNQNITRAVFENPRGDD-LDVPFR-GAG
4564|gene|nph       EEGGHIACGDAIKGTSTFPDVIDREYLREESFTNEGITLARFENPKGEN-LDIGFRGNNG
2954|gene|hut       QEAGHIACGDAIKGKSTFPEVIDLDYLREEAFTNQNIQRAQFEVPGGET-IEYPFATGSG
                     *.********:** . **:.*  . : . ::**  :  . ** *     ::  .  .  

881|gene|hut        AVIDRLEFGKLLIEGAADAGVTFHYDTVVNTVLQ-DGARVTGIEAIRKGEPVTYEAPVVI
4168|gene|nph       AVIDRWEYGRQLIDAAEDAGTEFHYDTVVQDVLQDDDGRVYGFSAIKKGDPRTYEAEIVL
439|chp|nrc1        AVIDRREYGRCVIDGAERTGVTFSYDTVVESVIQDDDGRVTGVTGIRDGRGHEFTGDIVI
10657|gene|hma      AVIDRWEYGRCLIEGANDSGVEFHYDTVVQDVLQDDSGRVTGVKAMRKGDPVTYEGDMVI
1311|gene|hhi       AVIDRWEYGRCLIEGANDSGVEFHYDTVVQDVLQDDSGRVTGVKAMRKGDPVTYEGDMVI
1520|gene|hwa       AVIDRLEYGNRLIEGAERAGTTFQYNTVVQDVVQNDSGTVVGVKATNDNHVIEYNADIVI
1413|gene|hla       AVIDRWEYGRRIIAGAEDAGVEFHYDTVINDVIQTGGGRVTGLRAKRKGTPVTYEADLVI
18390|gene|hbo      AVIDRWEYGRRLIDGAKNAGVEFHYDTVVQDVTQNDDGRVTGVRAKQNGDVVEYEADMTV
1534|gene|hwa       AVLDRKRYGEILIEEAERSGAEIQYDTVVQDVCQDDDGTVTGVRATRNGTVHTYNAEITI
23360|gene|hbo      AVVDRKRYGEVILEEADRLGTDMHYDTVVQDVSQDDDGRVTGVRAKRNGDVVEYEADVTI
4564|gene|nph       AIVDRKRYGEVLLEEADRVGAELHYNTVVQDVIQ-ENGVVRGVQAMRNGDALEYEADVVI
2954|gene|hut       SIVDRKRYGEVLLEEADRVGAELHFDTVVQDVVQTDDGHVEGVTATRKGERREYPADVVI
                    :::**  :*  ::  *   *. : ::**:: * *  .. * *. . ...    : . :.:

881|gene|hut        DAAGALSILQDEADLADATFDTNVTYSQFSSGYREIIEVEEPVEWHDALVLKPTERSAGY
4168|gene|nph       DGAGALSILQDKADFEDATFDTNVQYSQFSSAYREVIEVDEPVEWDDALVFKPTKRSAGY
439|chp|nrc1        DAAGSLSILQDKVDVSGATFDTNVSYSQFCSAYREIVEVPEPVEWDDALVFKPTDRAAGY
10657|gene|hma      DGAGALSILQDKTDLEAATFDTNVQYSQFCSAYREIIEVDEPVEWDDALVFKPTERSAGY
1311|gene|hhi       DGAGALSILQDKTDLEDATFDTNVQYSQFCSAYREIIEVDEPVEWDDALVFKPTERSAGY
1520|gene|hwa       DGAGALSILQDKADFSNTTFDTNVSYSQFCSAYREIVEVEEPVEWDDALVFKPTERAAGY
1413|gene|hla       DGAGSLSLLQDKADFEGTTFDTNVRYSQFCSAYREIVEVPEPVEWDDALVFKATDRAAGY
18390|gene|hbo      DGAGSLSILQDKTDFSGTTFDTNVSYSQFCSAYREIVEVEEPVEWSDALVFKPAEVAAGY
1534|gene|hwa       DAAGALSILQDKTDFTETYFDTNVSYSQFCSAYREVLEVPDPIEYDDAIVFKPTD-ELGY
23360|gene|hbo      DGAGALSILQDKTDFSGTTFDTNVSYSQFCSAYREVIDVPEPVDYDDAIVFKPTE-ELGY
4564|gene|nph       DAAGALSLLQDKADLGDATFDTKVNYQQFCSAYREVIEVPEPVEWDDAIVFKPTA-ELGY
2954|gene|hut       DAAGALSLLQDKADLAEATFDTNVTHRQFCSAYREIIEVEEPVDFDDAIVFKPTE-ELGY
                    *.**:**:***:.*.  : ***:* : **.*.***:::* :*::: **:*:*.:    **

881|gene|hut        LWYFPRTETEINVGLGFQMGEEPMELVDALRRDIENRAEFKNATVKDKLGASIPTRRPYD
4168|gene|nph       LWYFPRTPTEINVGLGFQMNEEPMKLVDDLREDISRRPELKGATVKDKLGAALPTRRPYD
439|chp|nrc1        LWYFPRTDTEINAGLGFQMTEEPMTLVDDLKADLQQRPEFEGAEVTDKLGAALPTRRPYD
10657|gene|hma      LWYFPRTDTEINAGLGFQMNEEPMELVDDLKRDLQGRSEFEGAEVQDKLGAALPTRRPYD
1311|gene|hhi       LWYFPRTDTEINAGLGFQMNEEPMELVDDLKRDLQGRSEFEGAEVQDKLGAALPTRRPYD
1520|gene|hwa       LWYFPRTETTINAGLGFQMSEEPMNLVDDLARDLRKRSEFNNATVKDKLGASLPTRRPYD
1413|gene|hla       LWYFPRTATEINAGLGFQMNEEPMQLVEALKRDLRNRPEFEGAEVKDKLGAALPTRRPYD
18390|gene|hbo      IWYFPRTETTINAGLGFQMTEEPMKLVDDLKRDLRARPEFKNATVSDKLGAALPTRRPYD
1534|gene|hwa       LWYFPRTATEINVGLGFQMTEDPMQLVETLKQDIMTRPELKNATVKDKLGASLPTRRPYD
23360|gene|hbo      LWYFPRSPTEINAGLGFQMTEEPMKLVDDLKRDLRNRPEFEGGTVTDKLGAALPTRRPYD
4564|gene|nph       LWYFPRTPTEINVGLGFQMNKEPMELVDELKADIRNRPEFEGATVKNKLGAALPTRRPYD
2954|gene|hut       LWYFPRTPTEINVGLGFQMDQEPMELVDTLRDDIENREEFQNATVTDKLGAALPTRRPYD
                    :*****: * **.****** ::** **: *  *:  * *::.. * :****::*******

881|gene|hut        SAVAPGFMAIGDAAAHVNPTTGGGIAGAAYAGKYAADQAIEAVEDGDPS-EATLWRYNER
4168|gene|nph       SATAPGYMAIGDAAAHVNPISGGGIAGAAYAGQYAGEAAIGAIEDGDVS-EANLWEYNER
439|chp|nrc1        SATAPGFMAVGDAAGHVNPTTGGGIAGAAYAGTYAGERAIRAAETGDVS-ESMLWEYNEH
10657|gene|hma      SAVAPGFMAVGDAAGHVNPTTGGGIAGAAYAGTYAAEQAIEAIEAGRTDDEAALWEYNER
1311|gene|hhi       SAVAPGFMAVGDAAGHVNPTTGGGIAGAAYAGTYAAEQAIEAIESGRTDDEAALWEYNER
1520|gene|hwa       SAVAPGFIAAGDAAGHVNPTTGGGIAGAAFAGMYAGQQAVTAISEGDVS-EASLWEYNER
1413|gene|hla       SAVAPGYMAVGDAAGHVNPTTGGGIAGAAYAGKYAGEQAVKAVSDGDVS-EENLWRYNTR
18390|gene|hbo      SAVAPGFVAVGDAAGHVNPTTGGGIAGAAYAGKYAGEQAVRAISDGDVS-EEALWHYNER
1534|gene|hwa       SAVADGFLAVGDAAGHVNPTTGGGIPGAAKSAHWAALHAVDAISEGDVS-ESRLWEYNTD
23360|gene|hbo      SAVAPGFIAAGDSAGHVNPTTGGGIPGAAKSAHWAAKHAVKAISDGDVS-EASLWEYNRD
4564|gene|nph       SATAPGYMAVGDAAAHVNPCTGGGIPGAAKAGTWAAEAAIEAISDGNADEEAALWEYNRR
2954|gene|hut       SGTAPGFIAVGDAAGHVNPTTGGGIPGAAKAGHWAAEVAADAIAAGDVS-EASLWEYNHR
                    *..* *::* **:*.**** :****.*** :. :*.  *  *   *  . *  ** **  

881|gene|hut        VMEHFGARYAALDVYNIFTTAYEIDDLTGMLASLPMTKLSEALYS-GSADLSWSLKLKTA
4168|gene|nph       VMDHYGGRYAALDVYNIFSTACDLDELLGLLAAMPAEKLSDALYS-GSAEVGLPLKLRVL
439|chp|nrc1        VMDHFGARYAALDVYNIMSTAIDVDDLMGLLAALPGQKLAEALYD-GSTQFGLKLKLVTA
10657|gene|hma      VMDHFGARYAALDVYNIFTTAYDVDDLMALLAALPGEKLAEALYG-GSTSIGLGLKLKMA
1311|gene|hhi       VMEHFGARYAALDVYNIFTTAYDVDDLMALLAALPGEKLAEALYG-GSTSIGLGLKIKMA
1520|gene|hwa       VMGDFGTRFAGLDVYNVLSTAIDVDDLMGLLASLPGEKLAEALYS-GTTSFSPLLILKTI
1413|gene|hla       VMDHFGGRYAGLDVYNVLSTAVDVDDLMGLLASLPGEKLAEALYE-GSTSMSFGLKLKAA
18390|gene|hbo      VMDHFGGRYAGLDIYNILSTAVDVDELMGLMARLPGEKLAEALYS-GTTSFGPKLIAQTA
1534|gene|hwa       VMTSFGKRFAAIDLYNLWGTAHNVDELVEIVSAVPGQQLADALSK-GTSSMSLKLKLKTL
23360|gene|hbo      VMTDFGKRFAAVDLYNIWGMAHDVDELVEIVSSLPGQQLLDSLSK-GSSSMGLGLQLQTL
4564|gene|nph       VQTDFGKRFAAMDLYNIWGGTHDVDELTDIVAAMPGQQLADALALEGTASMSWPLKIKTA
2954|gene|hut       VLTDFGKRFAAMDLYNIFGTTLTVEDISDVLAALPAQQLIDILGRSGTSSMGLGLKLKTM
                    *   :* *:*.:*:**:   :  ::::  ::: :*  :* : *   *::...  *     

881|gene|hut        LKSRGHWGTILDLYRTKRHADELLEHYEAYPESPSGFEAWQDRRDDLIQDVYETTGAEAK
4168|gene|nph       VKSFGHWKTLKELFDTKQLADRLLEHYETYPSSPEGLDAWQETRDEIMDDIYAQTGAEPK
439|chp|nrc1        LKSFGYWSEIMDFYRAKQQADRLLDHYRAYPSSPDGLADWQARRDDIMQSVYDVTGADAK
10657|gene|hma      VKSIGHLGTIRDLYQTKKAADRLLEHYESYPSDRSGFEAWQRERDSIMDDIYEVTGAEPK
1311|gene|hhi       VKSIGHLGTIRDLYQTKKAADRLLDHYQSYPSDRSGFEAWQRERDSIMDDIYEVTGAEPK
1520|gene|hwa       KNSYGHWGQILNFYRTKNLADDLMGQYERYPSRPEALDSWKSARDDVMDQIYDVTGADVK
1413|gene|hla       VKSFGYWGTIRNFYQTKSLADELLDHYGAYPTSPAAMANWTGERDAIMDRIYETTGADAK
18390|gene|hbo      KESYGFWSEIYQFYKTKNVADDLMRHYERYPRRPGALEGWKAERDRIMDHAYEVTGADPK
1534|gene|hwa       IDTFGHWDALYELYKVSRRATEITQIYDTYPDSPSAFKDWQANRDELMDEFYDLTGATRK
23360|gene|hbo      VKTFGHWDALYELYRVRKRAKEITTIYNAYPSSPRAFEGWQDSRDSVMDDLYDLVGTDPK
4564|gene|nph       VKTFGHWGTLFELKQLNDLATELKGVYDQYPTSPDDFADWRTERDELMDDVYELTGAEPK
2954|gene|hut       VQTFGHWGTLYDAYKVNKRASELKAIYDEYPTTPSGFEEWRAKRDGFMEDFYAEFGADPK
                     .: *.   : :       *  :   *  **     :  *   ** .::  *   *:  *

881|gene|hut        Y
4168|gene|nph       Y
439|chp|nrc1        Y
10657|gene|hma      Y
1311|gene|hhi       Y
1520|gene|hwa       Y
1413|gene|hla       Y
18390|gene|hbo      Y
1534|gene|hwa       Y
23360|gene|hbo      Y
4564|gene|nph       Y
2954|gene|hut       Y
                    *