HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0004COG1405KOG1598 KOG1597arCOG01981Transcription initiation factor TFIIIB Brf1 subunit/Transcription initiation factor TFIIBtranscription initiation factor IIB

HOG Organism Gene ID Name Annotation
cHOG0004 nrc1 VNG0315 tfbF transcription initiation factor IIB
cHOG0004 nrc1 VNG0734 tfbB transcription initiation factor IIB
cHOG0004 nrc1 VNG0869 tfbD transcription initiation factor IIB
cHOG0004 hmu HMUK3030 Hmuk_3030 Transcription factor TFIIB cyclin-related
cHOG0004 hmu HMUK2412 Hmuk_2412 Transcription factor TFIIB cyclin-related
cHOG0004 hmu HMUK1991 Hmuk_1991 Transcription factor TFIIB cyclin-related
cHOG0004 hma RRNAC1126 tfbH transcription initiation factor IIB
cHOG0004 hma RRNAC1357 tfbB transcription initiation factor IIB
cHOG0004 hma RRNAC1875 tfbD transcription initiation factor IIB
cHOG0004 hwa HQ1153A tfbA transcription initiation factor TFB
cHOG0004 hwa HQ1625A tfbA transcription initiation factor TFB
cHOG0004 hwa HQ1689A tfbA transcription initiation factor TFB
cHOG0004 hwa HQ2571A tfbA transcription initiation factor TFB
cHOG0004 hla HLAC1513 Hlac_1513 Zinc finger TFIIB-type domain protein
cHOG0004 hla HLAC1327 Hlac_1327 Transcription factor TFIIB cyclin-related
cHOG0004 hla HLAC0601 Hlac_601 Transcription factor TFIIB cyclin-related
cHOG0004 hbo HBOR22340 Hbor_22340 Transcription initiation factor IIB (TFIIB)
cHOG0004 hbo HBOR23010 Hbor_23010 Transcription initiation factor IIB (TFIIB)
cHOG0004 hbo HBOR24220 Hbor_24220 Transcription initiation factor IIB (TFIIB)
cHOG0004 hbo HBOR15380 Hbor_15380 Transcription initiation factor IIB (TFIIB)
cHOG0004 hut HUTA0083 Huta_0083 Transcription factor TFIIB cyclin-related
cHOG0004 hut HUTA0554 Huta_0554 Transcription factor TFIIB cyclin-related
cHOG0004 hut HUTA1187 Huta_1187 Transcription factor TFIIB cyclin-related
cHOG0004 hvo HVO_0795 HVO_0795 tfb transcription initiation factor
cHOG0004 nph NP2220A tfbA_2 transcription initiation factor TFB 2
cHOG0004 nph NP2246A tfbA_3 transcription initiation factor TFB 3
cHOG0004 nph NP4326A tfbA_5 transcription initiation factor TFB 5
cHOG0004 hhi 2547 tfb6 transcription initiation factor IIB
cHOG0004 hhi 2391 tfb5 transcription initiation factor IIB
cHOG0004 hhi 1946 tfb4 transcription initiation factor IIB
cHOG0004 hhi 1731 tfb3 transcription initiation factor IIB
cHOG0004 hhi 1674 HAH_1674 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1674|hp|hhi         ------------------------------------------------------------
2547|gene|hhi       MT----------TRSIYSPDE--------------------R------DESADEQAE---
869|gene|nrc1       MTNQR-------TTRDGSHGT---------------------------ESVPTQRSR---
1625|gene|hwa       MSDSL-------HARTRETEDDEQSDGRTWRDHSTTSERRGTRNSSKTTGSDESTTEQTS
23010|gene|hbo      MSDTE-------NARQRAKIDSE---------------------NRRTGRHNETEQT---
734|gene|nrc1       MSDS--------TIRTYSSDQ--------------------R------QTDNDETVS---
1513|gene|hla       MTET--------HIRGYNGETE-------------------RDRSTESTESTAEEAE---
11126|gene|hma      MSES--------TTRTSTR-----------------------------ERDEKITES---
1731|gene|hhi       MSES--------PTRTSTR-----------------------------ERDEQISEP---
2571|gene|hwa       MSDT--------RTREYTERESEKHDEETVDDKEASTTETR-------RRTETESEV---
15380|gene|hbo      MSDT--------TTREYVSTD--------------------R----RRENTDEAVTE---
1689|gene|hwa       MTNNSHQSPAITRARARRSDE--------------------RTETAQQDADTTVSDETTR
22340|gene|hbo      MTD---------RIRSSEMESAR-------------------------ARESDREAE---
1153|gene|hwa       MSEKTTHTCENARTRVESNNESEVTTNSAHDRIRTDGGTVGQRWVRPGEKESEEESVSES
24220|gene|hbo      MGQK--------WGRQ--------------------------------DESETESES---
601|gene|hla        MSE---------RLHTRGSRS---------------------------RTETDEKES---
315|gene|nrc1       MTDA--------RMR---------------------------------SREQERTDE---
1187|gene|hut       MSET--------NTRTRL------------------------------DQSTNVTED---
11875|gene|hma      MSE---------HTRTR-------------------------------QQREEQTTE---
2391|gene|hhi       MSE---------HTRTR-------------------------------QQHEEQTTE---
2246|gene|nph       MSE---------HIR---------------------------------TRTTETETE---
4326|gene|nph       MSDT--------GIRTYTEKS--------------------R------TETTEQTDE---
2220|gene|nph       MTDT--------TVRQY-------------------------------QRTDENEST---
554|gene|hut        MSET--------STRSRPTERTS-------------------------ERKTDEKVE---
83|gene|hut         MSDT--------TLRSHE------------------------------RANQRESTT---
1327|gene|hla       MSE---------NVRTYTAEHV--------------------------DETESETET---
11357|gene|hma      MTDT--------SIRRYSNE----------------------------RETETEQTE---
1946|gene|hhi       MTDT--------SIRRYSNE----------------------------RETETEQTD---
                                                                                

1674|hp|hhi         ------------------------------------------------------------
2547|gene|hhi       ---SEASTGHACPDCGG-SLVTDDSRGETVCEACGLVVDEDEIDHGPEWRAFDSQERDNK
869|gene|nrc1       ---ESTDEDHGCPECNG-DLVTDEDRGETTCGECGLVVEEDGIDHGPEWRAFNAQEQDEK
1625|gene|hwa       DESSTVEETVHCPECESTELITDDERGETVCADCGLVVDEDSIDRGPEWRAFDSAERDQK
23010|gene|hbo      ---ETDEETLLCPECSSPTLVTDDGRGETVCEDCGLVVDEDEIDRGPEWRAFDSAERDQK
734|gene|nrc1       ---TPDEDVLTCPECGG-QVIDDEEHGESVCVDCGLVVEENGIDRGPEWRAFNSTEKDEK
1513|gene|hla       ---STEERTTTCPECEG-NLITDTEHGETVCSECGLVVEQDSVDRGPEWRAFDSSERDSK
11126|gene|hma      ---TEQEAVETCPECSG-NVVTDTEHGETVCEDCGLVVEEDEIDRGPEWRAFNSAEKDRK
1731|gene|hhi       ---TEQEAVEACPECSG-NVVTDSEHGETVCEDCGLVVEEDEIDHGPEWRAFNSAEKDRK
2571|gene|hwa       ---ESESETHRCPECSG-NLIQDEARGETVCSDCGLVVDENSIDRGPEWRAFDSAERDQK
15380|gene|hbo      E--ETEEETQVCPECGG-SLITDEARGETVCGDCGLVVETDAVDRGPEWRAFNSSERDSK
1689|gene|hwa       S--AESTETVRCPECESTQLITDDERGETVCADCGLVVDEDSIDRGPEWRAFDSAERDQK
22340|gene|hbo      ---KTGDEETLCPECGSSNLTTDAEHGETVCDDCGLVVEEDEIDRGPEWRAFDAREKDQK
1153|gene|hwa       EE-ETTSESLVCPECSG-NVVADDEHGETICDDCGLVITEDSVDRGPEWRAFDAKEKDQK
24220|gene|hbo      ---ENTSEDLTCPECGG-NVVVDDEHGETVCADCGLVVTEDSVDRGPEWRAFDAAEKDQK
601|gene|hla        ---EQTDETLSCPECDG-NVINDEEHGESVCADCGLVVEADSVDRGPEWRAFDSREKDEK
315|gene|nrc1       ---TESESTDGCPECGG-LVVNDEEHGESVCADCGLVVEEDGIDRGPEWRAFDSKEKDEK
1187|gene|hut       ---EAETSDVQCPECDG-KLISDTERGETVCQGCGLVVEEDEIDPGPEWRAFDAKEKDQK
11875|gene|hma      ---STESESTACPECSG-SLVIDDEHGETVCEDCGLVVESDEIDRGPEWRAFDSSEKDEK
2391|gene|hhi       ---STESESTACPECSG-SLVIDDEHGETVCEDCGLVVESDEIDRGPEWRAFDSSEKDEK
2246|gene|nph       ---DERAETSGCPECGG-KLAADTEHGETVCRDCGLVVEEDEIDRGPEWRAFDSAEKDEK
4326|gene|nph       T--ERNEGVATCPECDA-RLQADTEHGETVCSDCGLVVEEDEIDRGPEWRAFDSAEKDEK
2220|gene|nph       ---SEDEDDLTCPECDG-RLQADTEHGETVCADCGLVVEEDEIDRGPEWRAFDSAEKDEK
554|gene|hut        ---HEETKTDVCPECGG-GLVTDSERGETVCGECGLVVEEDEIDPGPEWRAFDAAEKDQK
83|gene|hut         ---DEETKTDVCPECGG-GLVTDSERGETVCGECGLVVEEDEIDPGPEWRAFDAAEKDQK
1327|gene|hla       ---ESVDEELRCPECSG-QLASDTEHGETVCVDCGLVVEEDEIDRGPEWRAFDSSEKDEK
11357|gene|hma      ---EEESESLVCPECSG-ALLSDSERGETVCEDCGLVVEEDEIDPGPEWRAFDSKEKDEK
1946|gene|hhi       ---EEESETLVCPECNG-SLLSDSERGETVCEDCGLVVEEDEIDPGPEWRAFDSKEKDEK
                                                                                

1674|hp|hhi         ------------------------------------------------------------
2547|gene|hhi       RRVGAPTTEMKHDKGLSTNIGWQNKDAYGNSLSTRQREKMQRLRTWDERFRTRDHAERNL
869|gene|nrc1       SRVGAPTTNMMHDKGLSTNIGWQDKDAYGNTLSGRQRRKMQRLRKWNERFRTRNSKERNL
1625|gene|hwa       SRVGAPTTKLMHDKGLSTNIGWQDKDAYGNSLSSTQRQKMQRLRTWNERFRTRDSKERNL
23010|gene|hbo      SRVGAPTTNMMHDRGLSTNIGWQNKDAYGNSLSSNQRQKMQRLRTWNERFRTRDSKERNL
734|gene|nrc1       SRVGAPTTNMMHDKGLSTNIGWQDKDAYGNSLSSNQRQKMQRLRKWNERFRTRNSKERNL
1513|gene|hla       SRVGAPTTNMMHDKGLSTNIGWQDKDAYGKSLSSRQRQRMQRLRTWNERFRTRDSKERNL
11126|gene|hma      SRVGAPTTNMMHDKGLSTNIGWQNKDAYGRSLSSEQRQKMQRLRTWNERFRTRDSKERNL
1731|gene|hhi       SRVGAPTTNMMHDKGLSTNIGWQNKDAYGRSLSSEQRQKMQRLRTWNERFRTRDSKERNL
2571|gene|hwa       SRVGAPTTKLMHDKGLSTNIGWQDKDAYGNALSARQREQMQRLRTWNERFRTRDSKERNL
15380|gene|hbo      SRVGAPTTRMMHDKGLSTNIGWQNKDAYGKALSARQREQMQRLRTWNERFRTRNSKERNL
1689|gene|hwa       SRVGAPTTNLMHDKGLSTNIGWQDKDAYGNSLSSTQRQKMQRLRTWNERFRTRDSKERNL
22340|gene|hbo      SRVGAPTTNMMHDRGLSTNIGWQNKDAYGNSLSSTQRQKMQRLRTWNERFRTRDAKERNL
1153|gene|hwa       SRVGAPTTNTMHDKGLSTNIDWRDRDAYGNSLSSNQRQKMQRLRKWNERFRTRDSKERNL
24220|gene|hbo      SRVGAPTTNTMHDKGLSTNIDWRDRDAYGNSLSSNQRQKMQRLRKWNERFRTRDSKERNL
601|gene|hla        SRVGAPTTNTMHDKGLSTNIDWRDKDAYGRSLGARQRQKMQRLRKWNERFRTRDSKERNL
315|gene|nrc1       SRVGAPTTNTMHDKGLSTNIDWRDKDAYGNSLSSNQRQKMQRLRKWNERFRTRDAKERNL
1187|gene|hut       SRVGAPTTNMMHDKGLSTNIDWRDKDAYGNSLGSRQREKMQRLRKWNERFRTRDSKERNL
11875|gene|hma      SRVGAPTTNMMHDKGLSTNIDWRDKDAYGNSLSGKQRQKMQRLRKWNERFRTRDSKERNL
2391|gene|hhi       SRVGAPTTNMMHDKGLSTNIDWRDKDAYGNSLSGKQRQKMQRLRKWNERFRTRDSKERNL
2246|gene|nph       SRVGAPTTNMMHDKGLSTNIDWRDQDAYGNSLDSRQRQKMQRLRKWNERFRTRDSKERNL
4326|gene|nph       SRVGAPTTNMMHDKGLSTNIGWQDKDAYGNSLSSRQRQKMQRLRTWNERFRTRDSKERNL
2220|gene|nph       SRVGAPTTKMMHDEGLSTNIGWQDKDAYGNSLSSRQRQKMQRLRTWNERFRTRDSKERNL
554|gene|hut        SRVGAPTTNMMHDKGLSTNIGWQDKDAYGNSLSSRQREKMQRLRTWNERFRTRDSKERNL
83|gene|hut         SRVGAPTTNMMHDKGLSTNIGWQDKDAYGNSLSSRQREKMQRLRTWNERFRTRDSKERNL
1327|gene|hla       SRVGAPTTNMMHDKGLSTNIGWQDKDAYGKSLSSRQREKMQRLRTWNERFRTRDSKERNL
11357|gene|hma      SRVGAPTTNMMHDKGLSTNIGWQDKDAYGNSLSSRQREKMQRLRTWNERFRTRDSKERNL
1946|gene|hhi       SRVGAPTTNMMHDKGLSTNIGWQDKDAYGNSLSSRQREKMQRLRTWNERFRTRDSKERNL
                                                                                

1674|hp|hhi         ------------------------------------------MTVAGAAVYAADRLT-PE
2547|gene|hhi       KQALGEIDRMGSALGVPESARETASVIYRRALDEGMLPGRSIEGMATAALYAAIRQSNLP
869|gene|nrc1       KQALGEIERMASAFGLPDSVRETASVIYRRALGEDLLPGRSIEGVATSALYAAARQANTP
1625|gene|hwa       KQALGEIDRMASALGLPESVRETASVIYRRALDEDLLPGRSIEGISTAALHAAARMAQVP
23010|gene|hbo      KQALGEIDRMASALGLPESVRETASVIYRRALEDDLLPGRSIEGIATASLHAAARMAQVP
734|gene|nrc1       KQALGEIERMASALGLPKEVRETASVIYRRALSEDLLPGRSIEGVATAALYASARQLSTP
1513|gene|hla       KQALGEIDRMASALGLPDNVRETASVIYRRALSENLLPGRSIEGVATAALYAAARQAGNP
11126|gene|hma      KQALGEIDRMASALGLPQNVRETSSVIYRRALGDDLLPGRSIEGVATAALYAAARMAGNP
1731|gene|hhi       KQALGEIDRMASALGLPQNVRETSSVIYRRALGDDLLPGRSIEGVATSALYAAARMAGNP
2571|gene|hwa       KQALGEIDRMASALGLPESVRETASVIYRRALDEDLLPGRSIEGVATAALYAAARQAGTP
15380|gene|hbo      KQALGEIDRMASALGLPENVRETASVIYRRALDDDLLPGRSIEGVATSALYAAARQAGTP
1689|gene|hwa       KQALGEVDRMASALGLPENVRETASVIYRRALDEELLPGRSIEGVATASLYAAARQAGTP
22340|gene|hbo      KQALGEIDRMASALGLPENVRETASVIYRRALDDDLLPGRSIEGVATSALYAAARQAGTP
1153|gene|hwa       KQALGEVDRMASALGLPENVRETASVIYRRALDEDLLPGRSIEGVSTSCVYAAARMAGVP
24220|gene|hbo      KQALGEIDRMASALGLPENVRETASVIYRRALDDDLLPGRSIEGVATSCVYAAARMAGVP
601|gene|hla        KQALGEIDRMASAQGLPDNVRETASVIYRRALDEDLLPGRSIEGVSTSCVYAAARMAGVP
315|gene|nrc1       KQALGEIDRMASALGLPDNVRETASVIYRRALEDDLLPGRSIEGVATSCVYAAARQAGVP
1187|gene|hut       KQALGEIDRMASALGLPENVRETASVIYRRALDEDLLPGRSIEGVSTASVYAAARQAGVP
11875|gene|hma      KQALGEIDRMASALGLPENVRETASVIYRRALDEDLLPGRSIEGVSTASVYAAARQAGVP
2391|gene|hhi       KQALGEIDRMASALGLPENVRETASVIYRRALDEDLLPGRSIEGVSTASVYAAARQAGVP
2246|gene|nph       KQALGEIDRMASALGLPDNVRETASVIYRRALDENLLPGRSIEGVSTASVYAAARQAGVP
4326|gene|nph       KQALGEIERMASALGLPENVRETASVIYRRALSEDLLPGRSIEGVATAALYAAARQANVP
2220|gene|nph       KQALGEIERMASALGLPENVRETASVIYRRALDEDLLPGRSIEGVATASLYAAAKQARTP
554|gene|hut        KQALGEIDRMASALGLPENVRETASVIYRRALDENLLPGRSIEGVATASLYAAARQAGNP
83|gene|hut         KQALGEIDRMASALGLPENVRETASVIYRRALDENLLPGRSIEGVATASLYAAARQAGNP
1327|gene|hla       KQALGEIDRMASALGLPDNVRETASVIYRRALDEDLLPGRSIEGVSTSSLYAAARQAGTP
11357|gene|hma      KQALGEIDRMASALGLPENVRETASVIYRRALDEDLLPGRSIEGVSTASLYAAARQAGTP
1946|gene|hhi       KQALGEIDRMASALGLPENVRETASVIYRRALDEDLLPGRSIEGVSTASLYAAARQAGTP
                                                                :: :.::*: .     

1674|hp|hhi         KALTQADVVAAVSET---------------------------------------------
2547|gene|hhi       QTLDDMAVVSRVDEMEFTRAYRYLNRELSLQVGPPDPATYLSKFISELDADDALERQARA
869|gene|nrc1       RSLDEVASVSRVDRGEIARTYRYVARELSLEVAPTDPASYVPRFCSDLELSGDVERRARD
1625|gene|hwa       RSIDEVARVSRVDEDEFERAYRYIVRELSLEIQPADPAEYVPRFASDLEVPKETERTARE
23010|gene|hbo      RSLDEVAHVSRVDEEEFERAYRYIVRELSLEIKPADPTEYLPRFASDIDVPKETERTARE
734|gene|nrc1       RSIDEVANVSRIDEMEFKRTYRYIVRELSLEVAPADPAQYVPRFASDLDLPDEVERRSRE
1513|gene|hla       RSLDEISAVSRVDKMELTRTYRYVIRELKLEIQPADPGSYVPRFVSRLGLSEETQRVARE
11126|gene|hma      RSLDEMARVSRVEKMELTRTYRYIVRELSLEVQPADPEHYLPRFISDLDLSEETQRQARD
1731|gene|hhi       RSLDEMARVSRVEKMELTRTYRYIVRELSLEVQPADPEHYLPRFISDLGLSEETQRQARD
2571|gene|hwa       RSLDEIERVSRVDRMELTRTYRYVVRELKLEIEPADPEQYVPRFASDLDLSDESERQARE
15380|gene|hbo      RSLDELETVSRVDKMELTRTYRYVVRELKLEIEPADPEQYVPRFASELDLSDEAERQARD
1689|gene|hwa       RSLDEITNVSRVGRDEIARTYRYVVRELKLQIKPADPEQYVPRFASDLDLSDEAERRARQ
22340|gene|hbo      RSLDELETVSRVDKDEISRTYRYVVRELNLEIEPADPEQYVPRFASELGLNDESERHARQ
1153|gene|hwa       RSLDEIAEVSRVPKSEVARTYRYIARELSLEVKPADPEQYVPRFASELGLSDESTLRARQ
24220|gene|hbo      RSLDEISEVSRVEKSEVARTYRYIARELSLEVKPADPEQYVPRFGSELGLSDESKMRARQ
601|gene|hla        RSLDEIADVSRVEKAEIARTYRYVVRELKLEVKPADPEQYVPRFASDLELSEESEMRAKS
315|gene|nrc1       RSLDEIADVSRVEKAEIARTYRYVVRELGLEVAPADPESYVPRFASDLGLSDEASHRARE
1187|gene|hut       RSLDELTDVSRVEKDEIARTYRYVVRELGLEVRPADPESYVPRFTSDLELSEEAERRARE
11875|gene|hma      RSLDEITEVSRVEKSEIARTYRYVVRELSLEVRPADPESYVPRFASSLELSDEAEHRARQ
2391|gene|hhi       RSLDEITEVSRVEKSEIARTYRYVVRELSLEVRPADPESYVPRFASSLELSDEAEHRARQ
2246|gene|nph       RSLDEVAGVSRVEKSEIARTYRYVVRELGLEVQPADPESYVPRFASELELSEEAENRARQ
4326|gene|nph       RSLDEVEHVSRVDRMELTRTYRYIIRELNLEVQPADPESYIPRFVSDLDRSDEVERRARQ
2220|gene|nph       RSLDEVAKVSRVEKSEIARTYRYVVRELGLEIQPADPKSYVPRFASDIELSDEAERRARQ
554|gene|hut        RSLDEIERVSRIGRMELTRTYRYVVRELNLEVQPADPESYVPRFVSDLELNEEVSRRARE
83|gene|hut         RSLDEIDNVSRVEKDEVARTYRYVVRELKLEVKPADPTSYVPRFASDLELTEEAERHARD
1327|gene|hla       RSLDEIAAVSRVEKDEIARTYRYVVRELKLEIQPADPESYVPRFASDLGLSDEAERRARS
11357|gene|hma      RSLDEIAGVSRVEKDEIARTYRYVVRELSLEIQPADPESYVPRFASDLDLSEEVERRARQ
1946|gene|hhi       RSLDEIAGVSRVEKDEIARTYRYVVRELSLEIQPADPESYVPRFASDLDLSEEVERRARQ
                    .:: :   *: :                                                

1674|hp|hhi         ---------VPTSKSKIARYSQAVYEAGK-----------------THLTPTDSVAELVA
2547|gene|hhi       LIEAGKEANVHSGKSPVGLAAAAIYAAGLLLGEEMTQETVSEATDISTVTIRERYRELLE
869|gene|nrc1       LLAAAADAGITSGKSPVGLAAASVYAAALLTNERVTQNEVSTVANVSEVTIRNRYHEILD
1625|gene|hwa       LLESAKRQNVHSGKSPVGLAAAALYASAQLTNDELTQADVSEVTDISEVTIRNRYQELLE
23010|gene|hbo      LLENAKTVGIHSGKSPVGLAAAALYAAAQLTNEKVTQSDVSDVTDISEVTIRNRYQELLE
734|gene|nrc1       LISNAQADGVTSGKSPVGLAAAAIYASSLLTNHKVTQSEVSEVTDVSEVTIRNRYQELLE
1513|gene|hla       LLDSAKRAGITSGKSPVGLAASAVYAAALLSNEKVTQSQVSEVADISEVTIRNRYKELLD
11126|gene|hma      LVEGARQSGMLSGKSPVGIAAAAVYAAALLTNEKVTQSQVSDVADISEVTIRNRYKELLE
1731|gene|hhi       LIEGARQSGMLSGKSPVGIAAAAVYAAALLTNEKVTQSQVSDVADISEVTIRNRYKELLE
2571|gene|hwa       LLRNAKEEAIHSGKSPVGLAAAAVYAAALLTNEKVTQNEVSEVANVSEVTIRNRYKELLE
15380|gene|hbo      LLRNAKKAGIHSGKSPVGLAAAAVYAAALLTNEKVTQSEVSEVASISEVTIRNRYKELLE
1689|gene|hwa       LLRSAKEQGVHSGKSPVGLAAAAVYAASLLINEKVTQKEVSSVANISEVTIRNRYHELLE
22340|gene|hbo      LLRTAKEQGIHSGKSPVGLAAAAIYAASLLANEKVTQSEVSEVANISEVTIRNRYHELLE
1153|gene|hwa       LLQNAKEKGVHSGKSPVGLAAAAVYAAALLTNEKTTQAAVSEVADISEVTIRNRYHELLE
24220|gene|hbo      LLKNAKEKGVHSGKSPVGLAAAAVYAAALLTNEKTTQAAVSDVADISEVTIRNRYHELLE
601|gene|hla        LLRNAKEKGVHSGKSPVGLAAAAVYAAALLTNEKTTQAAVSEVADISEVTIRNRYHELLE
315|gene|nrc1       LLKTAKDKGVHSGKSPVGLAAAAVYAAALLTNEKTTQAKVSEVADISEVTIRNRYHELLE
1187|gene|hut       LLANAKEEGVHSGKSPVGLAAAAIYAASLLTNEKTTQAAVSEVADISEVTIRNRYHELLE
11875|gene|hma      LLQNAKEQGVHSGKSPVGLAAAAVYAAALLTNEKTTQAAVSEVADISEVTIRNRYHELLE
2391|gene|hhi       LLQNAKEQGVHSGKSPVGLAAAAVYAAALLTNEKTTQAAVSEVADISEVTIRNRYHELLE
2246|gene|nph       LLQNAKEQGVHSGKSPVGLAAAAVYAASLLTNEKTTQAAVSEVADISEVTIRNRYHELLE
4326|gene|nph       LIDNAREAGVISGKSPVGLAAAAVYAASLLCNEKVTQTEVSEVAEISEVTIRNRYKELLE
2220|gene|nph       LLDNAQEAGVVSGKSPVGLAAAAVYAASLLCNEKVTQKEVSEVADISEVTIRNRYHELLE
554|gene|hut        LVDSARKEGVLSGKSPVGIAAAAIYAAALLSNERVTQGEISEVADISEVTIRNRYKELLE
83|gene|hut         LLENAKQEGVHSGKSPVGLAAAAIYAASLLANEKVTQNEVSEVANISEVTIRNRYHELLE
1327|gene|hla       LLNTAKEQGLHSGKSPVGLAAAAVYAASLLVNEKVTQSEVSDVANISEVTIRNRYHELLE
11357|gene|hma      LLQNAKQEGVHSGKSPVGLAAAAVYAASLLTNEKVTQSQVSEVANISEVTIRNRYHELLE
1946|gene|hhi       LLQNAKQEGVHSGKSPVGLAAAAVYAASLLTNEKVTQSEVSEVANISEVTIRNRYHELLE
                             : :.** :.  : ::* :.                  : :*  :   *:: 

1674|hp|hhi         SD--------------------
2547|gene|hhi       AEAELDDSAVDATSGAESGASA
869|gene|nrc1       AG------------GEPGVEA-
1625|gene|hwa       AW-----DNRSN-GSGADAASA
23010|gene|hbo      AW-----DTTPFASGGESGASA
734|gene|nrc1       AT--------------EAAA--
1513|gene|hla       AS--------------EGLTA-
11126|gene|hma      AE---------------DLPA-
1731|gene|hhi       AE---------------DLPA-
2571|gene|hwa       AD--------------GAGVLA
15380|gene|hbo      VD--------------DAGLFA
1689|gene|hwa       AE--------------EQLSTA
22340|gene|hbo      AE--------------EQLMT-
1153|gene|hwa       AK--------------DAVGAT
24220|gene|hbo      AE--------------ESLGLA
601|gene|hla        AE--------------DGLVA-
315|gene|nrc1       AE--------------DTIPV-
1187|gene|hut       AE--------------QSIPTA
11875|gene|hma      AE--------------QDLPVA
2391|gene|hhi       AE--------------QDLPVA
2246|gene|nph       AE--------------QDLAFA
4326|gene|nph       AS---------------EVATA
2220|gene|nph       AE--------------QESGSA
554|gene|hut        AK------------SVDGTRVQ
83|gene|hut         AK--------------QDIRTA
1327|gene|hla       AE--------------DGATLN
11357|gene|hma      AE--------------DNIHP-
1946|gene|hhi       AE--------------DNIHP-