HOG Organism Gene ID Name Annotation
aHOG3990 hbo HBOR16140 Hbor_16140 hypothetical protein
aHOG3990 hla HLAC3481 Hlac_3481 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


16140|hp|hbo      MNDKIA-----------------------ILADPGRRTVLSCLDDHRGAVDIETLATDVV
3481|hp|hla       MNGKTSKSIAESALEDGSSSGITDDQLYRVFADPVRRTALAVLDDTSTPTSLETLAYGIE
                  **.* :                       ::*** ***.*: ***   ...:**** .: 

16140|hp|hbo      AAREGTSREAVTEADRDAALVRLHHVDLPKLDEAGFVEFDHEDGMVRRCRSEIATISPVV
3481|hp|hla       SDPEADV------ACVDACSVALHHRHLPILDEAGLVDYDPPTNTIRSCHGSVQAL----
                  :  *.        *  **. * ***  ** *****:*::*   . :* *...: ::    

16140|hp|hbo      SD
3481|hp|hla       VD
                   *